KEGG   Meleagris gallopavo (turkey): 100540873
Entry
100540873         CDS       T01523                                 

Definition
(RefSeq) cyclin-dependent kinase 7 isoform X1
  KO
K02202  cyclin-dependent kinase 7 [EC:2.7.11.22 2.7.11.23]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03022  Basal transcription factors
mgp03420  Nucleotide excision repair
mgp04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    100540873
  09124 Replication and repair
   03420 Nucleotide excision repair
    100540873
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100540873
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mgp01001]
    100540873
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mgp03021]
    100540873
   03019 Messenger RNA biogenesis [BR:mgp03019]
    100540873
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100540873
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100540873
    2.7.11.23  [RNA-polymerase]-subunit kinase
     100540873
Protein kinases [BR:mgp01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100540873
Transcription machinery [BR:mgp03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100540873
Messenger RNA biogenesis [BR:mgp03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Capping factors
     100540873
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     100540873
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 ABC1 APH Pkinase_fungal Haspin_kinase RIO1 FTA2 Kdo
Other DBs
NCBI-GeneID: 100540873
NCBI-ProteinID: XP_010723800
Ensembl: ENSMGAG00000004557
LinkDB
Position
Z
AA seq 174 aa
MDARARAKRYEKLDFLGEGQFATVYKAKDKTTGHIVAIKKIKLGHRSEAKDGINRTALRE
IKLLQELSHLNVIGLLDAFGHKSNISLVFDFMETDLEVIIKDTSIVLTQAHIKAYMLMTL
QGLEYLHQQWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRIYTHQVVTR
NT seq 525 nt   +upstreamnt  +downstreamnt
atggacgcgcgggctcgtgcgaagcgctacgagaaactggactttctgggggaagggcag
tttgctactgtgtataaggcaaaggacaagaccacggggcacatcgttgcaatcaaaaag
attaaactgggacaccgatcagaagctaaagatggaatcaacagaacagccctcagggag
ataaagttgctacaggaactaagccatctgaatgttattggtcttttagatgcatttgga
cacaaatctaatattagcttggtgtttgatttcatggaaacagaccttgaggttattata
aaggatactagtattgtgttaacacaagctcacatcaaagcatatatgctgatgacactt
caagggttagagtatttacatcaacagtggattctacacagggatcttaaaccaaataat
ttgctgttagatgaaaatggtgttttgaaattggctgactttggcttggcaaaatctttt
ggaagcccaaacagaatttacacacaccaagtagtaacaaggtaa

DBGET integrated database retrieval system