KEGG   Meleagris gallopavo (turkey): 100541216
Entry
100541216         CDS       T01523                                 

Gene name
CCNG1
Definition
(RefSeq) cyclin-G1
  KO
K10145  cyclin G1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100541216 (CCNG1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100541216
NCBI-ProteinID: XP_003210324
Ensembl: ENSMGAG00000002596
UniProt: G1MUL0
LinkDB
Position
15
AA seq 295 aa
MIETLVSGDARALLYRLTALLEQEPRCQPKGSGLRLIESAHDNGLRMTARLRDFEVKDLL
SLTQFFGFHTETFSLAVNFLDRFLSKMKVQPKHLGCVGLSCFYLAVKATEEERNVPLATD
LIRISQYRFTVSDMMRMEKIVLEKLSWKVKATTAFQFLQLYHSLIHENLSCERKRYLNFE
RLETQLKACHCRIMFSKAKPSVLALSIMALEIEEQKLLELTEALEFLQLHSKINNRDLTF
WKELVLKCLTEYSSSKCSKPNVQKLKWIVSGRTARQLKHSYYRITHLPTIPETTS
NT seq 888 nt   +upstreamnt  +downstreamnt
atgatcgagacgcttgtgagcggcgatgcccgcgcgctgctgtaccggctgacggctctt
ctggagcaggagccgcgctgccagccgaagggctccggcctgaggctgatcgagtccgcc
cacgacaacggcctccgaatgaccgcgaggctgcgagacttcgaagtgaaggatctgctc
agcttaactcagttcttcggcttccacacggagaccttctcgctggctgtcaacttctta
gataggttcttgtccaaaatgaaggtacagcctaaacacttgggctgtgttggactgagc
tgcttctacctggctgtgaaggcaacagaagaagagagaaatgttcccttagccaccgac
ttaattcgaataagccagtataggttcactgtttctgatatgatgagaatggagaaaatc
gtattggagaagctttcttggaaagtcaaagcaacaacagccttccagtttctacagctt
tatcattcgctcattcatgagaatttaagctgtgaaaggaaaagataccttaattttgag
agacttgagacccagcttaaggcatgtcactgcagaatcatgttttctaaagctaagcct
tctgttttagcactgtctattatggcactagagatagaagaacaaaaactactggagttg
acagaggcattggaatttctgcagttgcattccaagatcaacaacagagatttgaccttc
tggaaggaattggtgttgaagtgccttacagaatattcctcaagcaagtgttccaaacca
aatgtccagaaattaaaatggatcgtgtctggacgtacagcacggcagcttaagcatagc
tattatagaataacacaccttcctacaattccagaaaccacctcataa

KEGG   Meleagris gallopavo (turkey): 100550997
Entry
100550997         CDS       T01523                                 

Gene name
CCNG2
Definition
(RefSeq) cyclin-G2
  KO
K10146  cyclin G2
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04068  FoxO signaling pathway
mgp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100550997 (CCNG2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100550997 (CCNG2)
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 100550997
NCBI-ProteinID: XP_010707942
Ensembl: ENSMGAG00000005176
LinkDB
Position
4
AA seq 421 aa
MGGTQLRSAQQGQNALPTDCVWPRASRPSSGQSTQLVAPKSGHSVSSKFQQQADEAAHPE
LLGDQTERGRGFGQSDSTRRNTLRHALRLFRQLNLHLELEDRFQPRERGLSLIECAAENE
NTLCPRQRNAKVEDLWSLTNFFGFATETFVLAVNILDRFLALMKVKPKHLSCIGVCCFQL
AARVVEEECNIPSAHEIIRISQCKCTVSDLKRMEKIISEKLHFEFKATTALTFLHLYHTI
VLCHTSERKEVLNLDKLEAQLKACNCRLVFSKAKPSVLALCLLTLEVQSLKSVELLEILL
RVQKHSKISDCDLLYWRELVSKCLADYSSAECCKPDHKKLVWIVSRRTAQNLQNSYYSVP
ELPTIPEGGCFNESESEDSCEDMSSGEESLSSSPPSDLEGTFFFQLKPKTKWQTLNSQSL
H
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggggggcacgcagctgcgctcagcacagcaggggcaaaatgccctccccacagactgc
gtttggccacgggcctcccgtcccagcagtggccagtcaacacaacttgtggctcccaaa
agcgggcactcagtctcctccaagtttcagcagcaggcggacgaagctgctcaccctgag
cttctaggagatcagacagaacgtggccgaggtttcgggcagtcggacagcacacggcgg
aacacgctccgccatgcgctgcggctgttccggcagctgaacctccatctggaattggag
gaccgcttccagccccgcgagagggggctcagcctcatcgagtgcgcggccgagaatgaa
aacactctgtgcccgagacaaaggaatgctaaggtggaagatctctggagtctgaccaac
ttctttggttttgcaactgaaacattcgttttggctgttaacatcctggacagattcctg
gctcttatgaaggtgaaaccgaagcatttatcttgcattggagtttgttgttttcaactg
gctgcccgagtggttgaagaagaatgcaatattccatctgctcatgagattatccgaatc
agccaatgtaaatgcactgtgtccgacctgaaacggatggaaaagataatttcagaaaag
ttgcactttgaatttaaagctactactgccttaaccttcttgcacttgtaccatactatt
gtactctgtcatacctcagaaaggaaagaagtattgaatcttgacaaattggaagcacag
ctaaaagcttgcaactgtcgtcttgtgttttctaaagcgaaaccttctgtcttggccttg
tgccttctcactcttgaagttcaatctttgaaatctgttgagctgttagagatacttctg
cgtgttcaaaagcactcaaagataagtgattgtgacctgctttactggagggaactggtc
tcaaaatgcctggcagactattcttccgctgaatgttgcaagcctgatcataaaaagcta
gtttggattgtttcaaggcgcacagcccagaatctgcagaacagttactacagcgttcct
gagttgccaacaataccagagggtggctgtttcaatgaaagcgaaagtgaagactcctgt
gaagatatgagcagtggagaagaaagccttagcagttctcctcctagtgatctggaaggc
accttcttctttcaactcaagcctaaaacaaagtggcaaactcttaattctcagtctttg
cattaa

DBGET integrated database retrieval system