KEGG   Meleagris gallopavo (turkey): 100541513
Entry
100541513         CDS       T01523                                 

Definition
(RefSeq) caspase-8
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
mgp04210  Apoptosis
mgp04217  Necroptosis
mgp04620  Toll-like receptor signaling pathway
mgp04621  NOD-like receptor signaling pathway
mgp04622  RIG-I-like receptor signaling pathway
mgp04625  C-type lectin receptor signaling pathway
mgp05132  Salmonella infection
mgp05164  Influenza A
mgp05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100541513
   04217 Necroptosis
    100541513
   04115 p53 signaling pathway
    100541513
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100541513
   04621 NOD-like receptor signaling pathway
    100541513
   04622 RIG-I-like receptor signaling pathway
    100541513
   04625 C-type lectin receptor signaling pathway
    100541513
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100541513
  09172 Infectious disease: viral
   05164 Influenza A
    100541513
   05168 Herpes simplex virus 1 infection
    100541513
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mgp01002]
    100541513
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     100541513
Peptidases and inhibitors [BR:mgp01002]
 Cysteine peptidases
  Family C14: caspase family
   100541513
SSDB
Motif
Pfam: DED Peptidase_C14
Other DBs
NCBI-GeneID: 100541513
NCBI-ProteinID: XP_010711755
Ensembl: ENSMGAG00000007834
UniProt: G1N736
LinkDB
Position
7
AA seq 464 aa
MSSDFRKLLFDISEALATEELAALKFLSLEHVPVRKQEDTEEPKAFFEVLKEKGMIEVGD
LFFLKELLYRINRIDLLASHLGSSREEMERELQVPGKAKVSAYRQLLYGIAENLTPDDVR
SVKFLLQEKLPKNKLRDNASMLKILVEMERNGIIKEDDLTMLKSILKVFRADLKIKIDNY
EEKTKENDSNENLSFPVCVSTHPPGQGAEGGCVESYKMENNPHGYCVILNNYRFKNPDET
REGTVEDGKALKRVFKWLQFDTTEYMDLEAKQIFAKVKEYSKKDHSNMDCFVCFILSHGE
KDKIKGTDREHVNIKDLLSCFSGSNCPSLAGKPKLFFIQACQGCVGHPAVTVKEDSSGHL
EMDAIPLPSIPDQSDVLVGMATVEDFECYRSIEMGSVYIQCLCEKMELLCPLHKDLMTIL
TEVNKEVGRRVLNGWKQMPKITSTLRKQLIFQIPQCQSIEKQEK
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgagttcagacttccggaaactcctttttgacatttctgaggctttggccacagaagaa
ttggcagctctaaagtttctcagcttggagcatgtccctgtgaggaagcaggaagatact
gaggagcccaaagctttctttgaagtgctgaaggagaaagggatgatcgaggtgggggac
ctgttcttcttgaaggagctgctctaccggatcaatcggatagaccttctggcttcccac
ctgggctccagccgagaggagatggagagggagctccaggtcccagggaaggcaaaggtg
tcagcctatagacaactgctatacggaattgctgagaacttaactccagatgatgtcagg
agtgtaaaattcctgctgcaagaaaaattgccaaagaacaagctacgggataatgcttca
atgttgaagatattagtggaaatggaaagaaatgggataattaaggaagatgacctaaca
atgttgaagagtatattaaaggtatttagagctgacctaaagatcaaaattgataactat
gaagaaaaaacaaaagaaaatgattctaacgaaaatctgagctttccagtctgtgtgtct
acgcatccaccaggacaaggagcagagggtgggtgtgtggaatcatataagatggaaaat
aacccccatggttactgtgtgattctgaacaactaccgttttaaaaatccagatgaaacc
agagaaggaacagtggaagatggaaaagctctgaagagagtatttaaatggcttcagttt
gacacaactgagtacatggatctagaagcaaagcaaatctttgcaaaagttaaagaatac
agcaaaaaagatcatagcaacatggactgttttgtttgcttcattctttcacatggtgag
aaggacaaaataaaaggcactgatcgtgaacatgtaaatattaaagatttactctcctgc
ttcagtggatctaattgtccttctcttgctggcaagcccaagctatttttcatacaggcg
tgccaaggctgtgtaggtcatccagctgttacagtaaaggaagactcttctggtcatctt
gagatggatgctatccctctgccttctattcctgaccagtctgatgttctggttggcatg
gctactgtggaagattttgagtgctaccgttctatagagatgggcagtgtttacattcag
tgcctctgtgaaaagatggagctactttgcccacttcacaaggatctcatgaccattctg
acagaagtgaacaaggaagtgggaagaagagtattaaatgggtggaaacagatgccaaag
ataacatcaaccctacggaaacaacttattttccaaattccacaatgccagtcaattgaa
aagcaggaaaaataa

KEGG   Meleagris gallopavo (turkey): 100541666
Entry
100541666         CDS       T01523                                 

Definition
(RefSeq) caspase-8-like
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
mgp04210  Apoptosis
mgp04217  Necroptosis
mgp04620  Toll-like receptor signaling pathway
mgp04621  NOD-like receptor signaling pathway
mgp04622  RIG-I-like receptor signaling pathway
mgp04625  C-type lectin receptor signaling pathway
mgp05132  Salmonella infection
mgp05164  Influenza A
mgp05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100541666
   04217 Necroptosis
    100541666
   04115 p53 signaling pathway
    100541666
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100541666
   04621 NOD-like receptor signaling pathway
    100541666
   04622 RIG-I-like receptor signaling pathway
    100541666
   04625 C-type lectin receptor signaling pathway
    100541666
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100541666
  09172 Infectious disease: viral
   05164 Influenza A
    100541666
   05168 Herpes simplex virus 1 infection
    100541666
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mgp01002]
    100541666
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     100541666
Peptidases and inhibitors [BR:mgp01002]
 Cysteine peptidases
  Family C14: caspase family
   100541666
SSDB
Motif
Pfam: Peptidase_C14 DED
Other DBs
NCBI-GeneID: 100541666
NCBI-ProteinID: XP_003207543
Ensembl: ENSMGAG00000007846
UniProt: G1N764
LinkDB
Position
7
AA seq 482 aa
MEFSQLLFVISEALDRTELAALKFLSLEHVTVRKREDIEEPKAFFQALQEKGMIEVGDLF
FLKELLYRINRIDLLASHLGSSREEMERELQVPGRARVSPFRYLLFQLSENITKDDMKCF
KFLLGKELPKCKLSPETTMLDVFIEMEKKGILREDNLTVLKTICGKVDKSLLKKIEECGL
NSFGEGEMLVTEGQGSSTGAPEDSAIWLASSVAPNSLGNYDQTSQLEVYKMTSRPRGVCL
ILNNHNFAKAREAVPELRKMKNRNGTDVDADALRKVFSNLHFTVEVYRDCTAEEIRKIVN
NYRCMDHNNEDCFVCCILSHGKKGIIYGVDGQEVPIQELTTSFTGQNCQSLAGKPKVFFV
QACQGDAYQKGVTVETDSGEQDHSLETDARFQLDCIPSEADFLLGMATLQDYVSYRSPSQ
GTWYIQSLCQHLENSCPRGEDILTILTAVNQEVSSKIDKQNAGKQMPQPSFTLRKKLIFP
VN
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggagttctcccagctgctcttcgtgatcagcgaggcgctggacaggactgagctggca
gctctgaagtttctcagcctggagcacgtcactgtaaggaagcgggaagatattgaggag
cccaaggccttcttccaagcattacaagagaaagggatgatcgaggtgggggacttgttc
ttcttgaaggagctgctctaccggatcaatcggatagaccttctggcttcccacctgggc
tccagccgagaggagatggagagggagctccaggtcccaggcagagcacgggtgtctcca
ttcaggtatctgctctttcagctgtcagaaaacatcaccaaagatgacatgaagtgtttc
aagtttcttttgggaaaagaattaccaaaatgcaagctaagccctgaaactacaatgctc
gacgttttcattgagatggagaagaaggggattttgagagaagacaacttaactgtcctg
aagactatttgtggaaaagtggacaagagcctgttgaagaaaattgaagagtgtggatta
aactcatttggtgaaggagagatgcttgtaacagaggggcaaggaagcagcaccggagcc
cctgaagacagtgccatatggctggcatcatctgtggcacccaattctctgggcaactat
gatcagacttcacagcttgaagtttataaaatgaccagccgaccccgtggagtttgcctg
atcctgaataatcacaattttgcaaaagccagggaagcagtgccagaactcagaaagatg
aaaaatcggaatgggacagatgtggatgcagatgctctgagaaaagtctttagcaacctt
cattttacagtagaagtatacagagactgcactgcagaggaaatccgtaagatagtgaac
aactatcggtgcatggatcacaacaacgaagactgttttgtttgctgtattctctctcat
ggaaaaaaaggcatcatatatggtgttgatgggcaggaagtacctatccaggaactgacc
acttctttcactgggcaaaattgccaatcacttgctggaaaaccaaaagtcttctttgtt
caggcctgccagggtgatgcttatcagaagggtgtaaccgttgaaacagattccggggag
caagatcattctctagaaacagatgcaagatttcagctggactgcatcccctcagaggca
gacttcctcttgggcatggctaccctgcaagactatgtctcctacagaagcccaagccag
gggacctggtatatacagtcactgtgccaacacttggagaacagctgtcctcgaggagaa
gatattctcaccatactgacagcagtgaatcaagaggtgagcagcaagattgacaagcag
aatgcaggaaagcaaatgccacagcccagtttcacactgaggaaaaaactcatatttcct
gtaaactaa

DBGET integrated database retrieval system