KEGG   Meleagris gallopavo (turkey): 100541630
Entry
100541630         CDS       T01523                                 

Gene name
PPM1D
Definition
(RefSeq) protein phosphatase 1D
  KO
K10147  protein phosphatase 1D [EC:3.1.3.16]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100541630 (PPM1D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mgp01009]
    100541630 (PPM1D)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100541630 (PPM1D)
Protein phosphatases and associated proteins [BR:mgp01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    100541630 (PPM1D)
SSDB
Motif
Pfam: PP2C UBA2_C
Other DBs
NCBI-GeneID: 100541630
NCBI-ProteinID: XP_010720456
Ensembl: ENSMGAG00000007680
LinkDB
Position
21
AA seq 355 aa
MWDGEERGGEEGERKGRAVGLRVRGGCDLWSYDFYTGEFVVSPEPDTSVHTIDPQKHKYI
ILGSDGLWNMIPPQDAISMCQDHEEKKYFMGEHRQSCAKMLVNRALGRWRQRMLRADNTS
AIVICISPLQDSKNNLENEEELYLNLAESPCYSSPDTNVMTPSHCCTPPVKLLEDDPWPR
LNASEPVPSLMHSSMISEKYAELPNEIAKSNLPSSGAALKDSGPQDEKCSKALALRIQES
YSNGLSVSLSPSNSTNSGTDQKGLKVSPNSQTKAQDAERTPTANFKRTLEESNSGPAVKK
PRRGLSRNMGVQAEGISTTLQRKNSNKLAMRRSLRGQKKLGSSLFHPPRKAVCVC
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgtgggacggagaggagaggggaggggaggagggagagagaaagggaagggcggtgggg
ttacgggtacgtggggggtgtgatctgtggagctacgacttctacactggtgaatttgtt
gtgtctcctgaacctgacactagtgtgcacaccatcgatccccagaagcacaagtacatt
atccttggcagtgacggactgtggaacatgatcccacctcaagatgctatctccatgtgc
caggatcacgaggagaaaaagtacttcatgggtgagcaccgccagtcctgtgccaaaatg
ctggtgaacagagcactgggccggtggaggcagcgcatgcttcgtgcagataacaccagt
gccatcgtgatctgcatctcaccactgcaggatagcaaaaacaacttggaaaatgaagaa
gaactgtatctcaacttggcagagagtccctgctatagcagccctgatacaaatgtcatg
acgccctcccactgctgcaccccacctgtcaagcttttagaggatgatccgtggccacga
ctgaatgcttctgagcctgttccctccctcatgcatagcagcatgatctcagaaaaatac
gccgagctgccaaacgagattgccaaaagcaatttaccttcatcaggagcagccctaaag
gattcaggtccacaggacgagaagtgcagcaaagcgttggctttgaggatacaggaatcc
tacagtaatggtttgtcagtcagtctatccccatccaactctacaaattcaggcacggac
caaaaaggcttaaaggtgtctcctaacagccaaacaaaagcccaggatgcggagaggaca
cccacagcaaactttaaaaggacattagaagaatccaattctggccctgctgtgaagaag
ccgaggcgcggcctgagccgaaacatgggtgtccaagcagagggcatatccacaacgctg
cagcgcaagaactcaaacaagctggccatgcggcgcagcctgcgcggccagaagaagctc
ggcagttcactcttccacccacccaggaaagcagtctgcgtttgctga

DBGET integrated database retrieval system