KEGG   Meleagris gallopavo (turkey): 100541674
Entry
100541674         CDS       T01523                                 

Gene name
XPC
Definition
(RefSeq) LOW QUALITY PROTEIN: DNA repair protein complementing XP-C cells
  KO
K10838  xeroderma pigmentosum group C-complementing protein
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    100541674 (XPC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100541674 (XPC)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      100541674 (XPC)
SSDB
Motif
Pfam: BHD_3 Rad4 BHD_1 BHD_2
Other DBs
NCBI-GeneID: 100541674
NCBI-ProteinID: XP_003210173
Ensembl: ENSMGAG00000007750
LinkDB
Position
14
AA seq 957 aa
MARKRKASVVRKPAGKRRPGGXGVRRDGEEEREEGDFVEEKPSVKKSRAGVAAKKKEDDG
DAGVAKSADKPSKQKRRAKENEKSPENKGTRHKEQTCSDSPKASQKEIKLKRESLIKKEM
DEDNTDDDDDESEDEWEDVEELQEPVVDKLEEGAVLPAVVLPSNPVEIEIETPEQLKRRE
RREKRKAEFETYVRRMIKRFTKEVREDTHKVHLLCLLANGFYRNRICSQPDLHAIGLSII
PIHFTKVPAGQVDLLYISNLVKWFVGTFTVNDELSSEKGEPLQSTLERRFAIYAARDDEE
LVHIFLIILRALQLLCRLVLSLQPIPLKETKAKEKSTSKKQSLSSTSEGQESSGTTPKVV
AKKCPCKKAKRDEKSSGSEEDNEESKKTKSAQTKRTHKSKLTTGNKEQKETGNEDSGLGE
KDVPIRPKNSRRRRVASKVCYKEESGSDEGSVSDFEISGEESDISDEDFETVSKKRRSSR
GAQKSKVMTMKSPKSETSESRLSRCSLGVEPRPAKTAAPSLPRAQRKRNKIISSDEDDGQ
QMVQKVVGTDQWLEVFLEREDRWVCVDCVHGIVGQPQQCFTYATKPLSYIVGFDNDGSVK
DVTQRYDPVWMTTTRKKRVDPEWWEDTLQPYKSPFADRDKKEETEFQVKLQDQPLPTAIG
EYKNHPLYALKRHLLKYQAIYPESAAILGYCRGEAVYSRDCVHTLHSKDTWLKQARVVRI
GEVPYKMVKGYSNQARKARLAEPANRDKADLALFGRWQTEEYQPPIAVDGKVPRNEYGNV
YLFLPSMLPVGCVQLRLPNLNRLARKLDIDCAQAVTGFDFHGGYSHAVTDGYVVCEEYKE
VLIAAWENEQAEIEKKEKEKREKRALGNWKLLTKGLLIRERLKQRFSIKAEPSAPETEKG
AGFSSDEEGPNSGTAGGDMEIFWPRNRQAEKQKEKTTRKSKREKKDEAAQLFPFEKL
NT seq 2874 nt   +upstreamnt  +downstreamnt
atggcgaggaagcgcaaagcgtccgtcgtgcggaagcctgccggcaaaaggcggccgggg
gggncgggagtgcggcgggacggcgaggaggaacgcgaagagggtgattttgtggaggaa
aaacccagcgtaaagaagagcagagccggagttgcagctaagaagaaggaggacgatggt
gatgctggagttgccaagtcagcagataagccttcaaaacaaaaacggcgagcaaaagaa
aatgagaaaagccctgaaaataaagggactcgtcacaaagagcaaacgtgcagtgactca
ccgaaggcctctcagaaggagataaaattgaagagagaatctcttattaaaaaagaaatg
gatgaagacaatactgatgatgatgatgatgaaagtgaagatgaatgggaggatgtggag
gaactccaggagcctgtcgtagataagttagaagaaggtgctgttcttccagcagtggtg
ctgccaagcaatcctgttgagatagagattgaaaccccagaacaacttaagagaagagag
agaagagagaaaaggaaagctgagtttgagacttatgttcggagaatgattaaacgtttc
actaaggaggttcgtgaggacacacacaaggttcacctcttgtgtttattagcaaatggt
ttctataggaacaggatctgcagccagccagatcttcatgccattggtctatccatcatc
cccatacacttcacaaaagttcctgcaggccaagtggaccttctctacatttccaacttg
gtgaaatggtttgttggaaccttcactgtcaatgatgaactttccagtgaaaaaggagag
ccccttcagtcgaccttggagaggcgctttgccatctatgctgcacgagatgatgaagag
ttggttcatatatttttaattattctcagggcgttgcagctgctgtgtcgcctcgtgctg
tccttacagcctattcctctcaaggagacgaaggcaaaggaaaaaagcacatccaagaag
cagtcgctcagcagtacctctgaggggcaggagagctcaggcacaacacccaaagttgtg
gcaaaaaaatgcccctgcaaaaaagccaaacgggatgagaaatcatcagggagtgaagaa
gacaatgaggagtcaaagaaaacaaaaagtgctcagaccaaaaggacacacaagtcaaaa
ctgacaacaggcaacaaggaacagaaggagactgggaatgaggacagtggtctaggggaa
aaagatgtgccgatcagacccaagaacagtcggcggagacgagtggcctccaaagtgtgt
tacaaagaagagagtggaagtgatgagggcagtgtttctgactttgagatttcaggagag
gaaagtgatatctccgacgaggactttgaaactgtctctaaaaagcggagaagctcacga
ggtgcccagaaatcaaaggtaatgactatgaaaagccccaaaagtgagacttcggaatca
aggctatccagatgttctttgggagttgagccaagaccagcaaaaaccgcagctccaagc
ttgcctcgtgcacagagaaagagaaacaaaataatttctagtgatgaggatgatgggcag
cagatggtacagaaagtggttggcacagaccagtggctagaggtttttcttgaacgtgag
gacaggtgggtgtgtgtagactgcgttcatggcattgttggccagccccagcagtgcttc
acgtatgccacaaagccactttcctacattgtgggatttgacaatgatgggagcgtcaag
gatgtgacacaaagatacgacccagtgtggatgaccacgacaaggaagaaacgtgtggat
cctgagtggtgggaagacacactgcagccatataaaagtccctttgcagacagagacaag
aaggaggaaacagagtttcaggttaagcttcaggatcagcctctaccaacagcaattgga
gagtacaaaaaccaccctctgtatgcactgaagaggcatctcttgaaatatcaggccatc
tatcctgagtcagctgctatcctagggtactgcaggggagaggctgtttattcgagagac
tgtgtacacacgcttcactccaaggacacttggcttaagcaggctcgagtggtgaggatt
ggagaagtgccttacaaaatggtgaagggctactccaaccaggccaggaaggcacgcctt
gcagagcctgcaaaccgggacaaagcggacctggcactgtttggtcgctggcagacagag
gagtatcagccacccatagcagtggatggaaaggttcctcggaatgaatatggaaacgtc
tatctcttcctgccctctatgttacctgttggttgtgtgcagcttaggctccccaacctg
aacagattggcacggaagctggacattgactgtgctcaagctgtcactgggtttgacttc
catggtggctactcacacgcagttactgatggttatgttgtctgtgaagaatataaagag
gtgctcattgctgcctgggagaatgaacaagcagaaatagaaaagaaggagaaggagaag
cgtgagaagagagctctgggaaactggaagttgctgacaaaaggacttctcattagagag
agactgaagcaacgcttctccatcaaggctgagccatcagcacctgagacagagaaagga
gcaggattctcctctgatgaagaaggcccaaattcagggactgcaggaggggatatggaa
attttttggccccgaaatcgccaggcagagaagcagaaagagaagacaaccagaaaaagc
aagcgggaaaagaaggacgaagcagcacagttgtttccttttgagaaattgtga

DBGET integrated database retrieval system