KEGG   Meleagris gallopavo (turkey): 100542010
Entry
100542010         CDS       T01523                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04010  MAPK signaling pathway
mgp04020  Calcium signaling pathway
mgp04144  Endocytosis
mgp04510  Focal adhesion
mgp04540  Gap junction
mgp04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100542010 (PDGFRA)
   04020 Calcium signaling pathway
    100542010 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100542010 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100542010 (PDGFRA)
   04540 Gap junction
    100542010 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100542010 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mgp01001]
    100542010 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mgp04090]
    100542010 (PDGFRA)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100542010 (PDGFRA)
Protein kinases [BR:mgp01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100542010 (PDGFRA)
CD molecules [BR:mgp04090]
 Proteins
  100542010 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 100542010
NCBI-ProteinID: XP_010708408
Ensembl: ENSMGAG00000011850
LinkDB
Position
4
AA seq 903 aa
MGTPPRTFLILGCFLTGPILTLCQLPLPTIVPNRNEMVVQLNSNFTLKCSGDSEVSWQYP
VTEGSHRIDIRHEENNSGLFVTVLEVGNASAAHTGMYVCYYNHTQVEDGEVEGKDIYIYV
PDPDMPFVPSLPEDQFILVEEGDPTVIPCRTSDPSAEVTLVNSLDKPVYAFYDSKQGFVG
NFLAGPYTCKTMVKGMEFKSDEFLIYILRATSQLPVEIEALKTVYKTGETIVVTCVVFDN
EVVNLQWNYPGKVKEKGLIKLDDIKVPSQKLVYTLTIPDASVKDTGDYECTARHATKEVK
ENKKVVITVHDKGFIHLEPQFSPLEAVNLHEVKNFVVDVQAYPAPKMYWLKDNVTLIENL
TEIVTSSNRVQETRFQSVLKLIRAKEEDSGYYTLVAENEDEIKRYTFSLLIQVPALILDL
MDDHQGSAGRQTVRCLAEGTPLPDVEWLVCKDIKKCSNDSSWTLLTNNISDIHMEAHLDE
KNMVESQVTFQKVEETLAVRCVARNDLGAVTRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSRHPEKPKKDLDIFGMNPADESTRSY
VILSFENTGEYMDMKQADTTQYVPMLERKEGSKYSDIQRSVYDRPASYKKKSLSESEVKN
LLSDDSSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGMYCEHFLT
CCN
NT seq 2712 nt   +upstreamnt  +downstreamnt
atgggtactcccccaaggacgttcctgatcctgggatgttttctcacaggaccgatccta
acactttgccagcttcctctgccgactattgttcccaacagaaatgagatggttgtacag
ctgaattccaatttcacactcaaatgctctggagacagcgaagtgagctggcagtacccg
gtgactgagggaagccacaggatagacatcaggcacgaggagaacaacagtggcctcttc
gtgacagtgctcgaagtcggaaatgcctcagccgctcacacgggcatgtacgtttgctat
tataaccacacgcaagtggaggatggggaagttgaggggaaggacatctacatctatgtg
cctgacccagacatgccttttgttccttccttaccagaagaccagttcatcctagtagaa
gaaggtgatcccaccgttatcccttgtcggacaagtgacccaagcgctgaagtgacttta
gttaacagtttagacaagcctgtctatgctttctatgacagcaaacagggcttcgtaggg
aatttccttgcaggaccatatacatgcaaaacaatggttaaaggcatggagttcaagtcc
gatgagttcctcatctatattttaagagctacttcacagctgccggttgaaattgaagct
ctgaagactgtctacaaaacaggcgagaccatcgtagtaacttgtgtggtctttgacaat
gaggtggttaatttacagtggaattatcccgggaaagtgaaagaaaaaggtctgataaaa
cttgatgatatcaaagtcccatcgcagaagttggtttacacgttgaccattcctgacgca
tcagtgaaagacacaggggattatgaatgtactgctcgacatgcaaccaaggaggttaag
gaaaataagaaagtagtcattacagttcatgacaaagggttcattcatctagagcctcag
tttagccctttggaagctgtcaatctacatgaagtcaaaaattttgtcgtcgatgtgcag
gcgtaccccgctccaaaaatgtactggttgaaggataatgtgactctgattgaaaatctt
actgagattgttactagttcaaacagggtccaggaaacacggtttcaaagtgtactaaaa
ttgatccgggccaaggaagaagacagtgggtactatactttggttgctgaaaatgaagat
gagattaagagatacaccttctcgttactaattcaagttccagccttgattttagacctc
atggatgaccaccaaggctctgctggcaggcagacagtgaggtgcttggctgaagggacc
ccgcttcctgatgtggaatggctggtttgcaaggacattaaaaaatgcagcaatgactct
tcctggactcttctgactaacaatatctctgatatacacatggaagcccacctggatgag
aagaatatggtagaaagccaggtgaccttccagaaggtagaggaaaccctggctgtgaga
tgtgtagcaagaaacgaccttggtgctgttactcgggaactgaaacttgtggctcccacc
ttgcgatcagaactgacggtggctgctgccgtcttagtactgttggtgattgtgataatt
tcactgattgtcctggtcatcatctggaaacagaagccaaggtatgagataagatggaga
gtcattgagtctatcagccctgatgggcatgaatacatttatgtggacccaatgcagcta
ccgtatgactccagatgggagtttcctcgagatgggttagtgcttggtcgaatccttggt
tctggtgcattcggaaaagtggtggaagggacagcatatggactgagtcgttctcaacca
gtgatgaaagtagctgtgaaaatgctgaaacctacggctagatccagtgaaaaacaggca
ctcatgtctgaactgaagataatgacacatcttgggccccatctgaatattgtgaacctg
cttggagcttgtacaaaatcaggtcctatttacataatcactgaatactgcttttatggt
gatttggtgaactatctgcacaagaacagggacaacttcctcagccgacatccagagaaa
ccaaagaaagatctggatatttttgggatgaacccagctgatgaaagcacaagaagctat
gtgattttatcatttgaaaacactggagaatacatggacatgaaacaagctgatacaact
cagtacgtgccaatgctggaaaggaaagagggatctaaatactctgacattcagagatct
gtatatgatcgacctgcttcatataagaagaaatctttgtcagaatcagaagtaaaaaac
cttctttcagatgacagttcagagggtctgagcctactggatttgctaagcttcacctac
caggttgcacggggaatggaattcttggcttctaaaaattgtgtacaccgtgacttggca
gctcgtaatgtccttctggctcaaggcaaaatcgtgaagatctgtgactttgggttggct
agagacatcatgcatgattccaactacgtctccaagggcagcactttccttccagtaaaa
tggatggcacctgaaagcatttttgacaatctgtacacaacattaagtgatgtctggtct
tatggtattctgctgtgggaaatattttctcttggtatgtactgtgaacactttcttaca
tgttgtaattaa

DBGET integrated database retrieval system