KEGG   Meleagris gallopavo (turkey): 100542044
Entry
100542044         CDS       T01523                                 

Definition
(RefSeq) cyclin-dependent kinase 2
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04068  FoxO signaling pathway
mgp04110  Cell cycle
mgp04114  Oocyte meiosis
mgp04115  p53 signaling pathway
mgp04218  Cellular senescence
mgp04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100542044
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100542044
   04114 Oocyte meiosis
    100542044
   04115 p53 signaling pathway
    100542044
   04218 Cellular senescence
    100542044
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100542044
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mgp01001]
    100542044
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    100542044
   03036 Chromosome and associated proteins [BR:mgp03036]
    100542044
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100542044
Protein kinases [BR:mgp01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100542044
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100542044
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100542044
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH
Other DBs
NCBI-GeneID: 100542044
NCBI-ProteinID: XP_019466658
Ensembl: ENSMGAG00000016781
LinkDB
Position
Unknown
AA seq 208 aa
MDASSLGGIALPLIKSYLFQLLQGLAFCHAHRVLHRDLKPQNLLINADGAIKLADFGLAR
AFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEID
QLFRIFRTLGTPDEAAWPGVTTLPDYKPSFPKWARQDLGKVVPLLDEEGRKLLAQMLHYD
PNKRISAKAALGHPFFRDVTRAVPHLRL
NT seq 627 nt   +upstreamnt  +downstreamnt
atggatgcatcatccctgggcggcatcgcgctgccgctcatcaagagctacctgttccag
ctgctgcaaggcctggccttctgccacgcacaccgcgtcctgcaccgagacctcaagcct
cagaacctgctcatcaacgccgacggtgccatcaagctggctgactttgggctggcacgc
gcctttggggtgcctgtgcgcacctacacgcacgaagtggtgacgttgtggtaccgtgcg
cctgagatcctgctgggctgcaagtactattcgactgccgtggacatctggagcctgggt
tgcattttcgccgagatggtgacgcggcgcgcgctcttccccggggattcggagatcgat
cagctcttccgtatcttccgcacgctggggacaccggatgaggccgcctggcccggcgtc
accaccctgcctgactacaagcccagcttccccaaatgggcccggcaggatctgggcaag
gtggtgccgctgctggatgaggagggccgcaagctgctggcgcaaatgctgcactacgat
cccaacaaacgcatctcggccaaagcagcgctgggccaccccttcttccgtgatgtcacc
agggctgtcccccacctgcgcctgtga

DBGET integrated database retrieval system