KEGG   Meleagris gallopavo (turkey): 100542100Help
Entry
100542100         CDS       T01523                                 

Gene name
ACE
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mgp01002]
    100542100 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mgp04147]
    100542100 (ACE)
   04090 CD molecules [BR:mgp04090]
    100542100 (ACE)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100542100 (ACE)
Peptidases [BR:mgp01002]
 Metallo Peptidases
  Family M2
   100542100 (ACE)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100542100 (ACE)
CD molecules [BR:mgp04090]
 Proteins
  100542100 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Peptidase_M32
Motif
Other DBs
NCBI-GeneID: 100542100
NCBI-ProteinID: XP_010722791
Ensembl: ENSMGAG00000001530
LinkDB All DBs
Position
29
AA seq 1281 aa AA seqDB search
MPAALGLLLPWLSLVGALQPGLEPPEFDPTEAGAVLFADAYNSTAEIVLFQSVSASWNYN
TNLTTANAALQVEASLEEQNFTELWGKKAKELYGNMWSNFSDPQLKKIIGSIQTLGPSNL
PLDKRQQYNTILSDMDKIYSTAKVCLDNGTCWDLEPDISDIMASSRSYKKLLYAWEGWHN
AAGNPLRAKYEEFVTLSNEAYQMDGFEDTGSYWRSWYDSTTFEDDLEHLYNQLEPLYLNL
HAFVRRKLYDRYGPKYINLKGPIPAHLLGNMWAQQWNNIYDLMVPYPDKPNLDVTSTMVN
QGWNATHMFRVSEEFFTSLGLLEMPPEFWDKSMLEKPADGREVVCHASAWDFYNRKDFRI
KQCTTVTMEQLFTVHHEMGHVQYYLQYKDQPVSFRGGANPGFHEAIGDVMSLSVSTPSHL
QKIGLLSSAVEDEESNINYLLKMALEKIAFLPFGYLIDQWRWNVFNGRTPPSRYNYDWWY
LRTKYQGICAPVSRNESNFDPGAKYHIPGNTPYIRYFVSFILQFQFHKALCQAANHTGPL
HTCDIYMSKEAGAKLREVLKAGSSKSWQEILFNLTGTDKMDAGALLEYFSPVTTWLQEQN
NKTNEVLGWPEFDWRPPVPEGYPEGIDKIVDEAQAKEFLSEYNSTAEVVWNAYTEASWDY
NTNITDHNREVMLEKNLAMSKHTIEYGMRARQFDPSDFQDETVTRILNKLSVLERAALPE
DELMEYNTLLSEMETTYSVAKVCRENNTCHPLDPDLTDILATSRDYNELLFAWKGWRDAS
GAKIKDKYKRYVELSNKAAVLNGYTDNGAYWRSLYETPTFEEDLERLYLQLQPLYLNLHA
YVRRALYNKYGAEHISLRGPIPAHLLGNMWAQSWSNIFDLVMPFPDATKVDATPAMKQQG
WTPKMMFEESDRFFTSLGLIPMPQEFWDKSMIEKPADGREVVCHASAWDFYNRKDFRIKQ
CTVVNMDDLITVHHEMGHVQYFLQYMDQPISFRDGANPGFHEAIGDVMALSVSXPKHLHS
INLLDQVTENEESDINYLMSIALDKIAFLPFGYLMDQWRWKVFDGRIKEDEYNQQWWNLR
LKYQGLCSPVPRSEDDFDPGAKFHIPANVPYIRYFVSFVIQFQFHEALCKAAGHTGPLHT
CDIYQSKEAGKLLGDAMKLGFSKPWPEAMQLITGQPNMSAEALMSYFEPLMTWLVKENTK
NGEVLGWPDYSWTPYAATELHAATDTTDFLGMSVGTKQATAGAWVLLALALVFLIVSIFL
GVKLFSSRRKAFKSSSEMELK
NT seq 3846 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcggctttagggctgctgctgccgtggctgagcctggtgggtgccctgcagccg
gggctggaaccccccgagttcgaccccaccgaggctggggccgttctcttcgccgatgcc
tacaacagcacggcggagatcgtcctcttccaaagcgtgtctgccagctggaactacaac
accaacctgacgaccgccaacgctgccctgcaggtcgaggcatcgctggaggaacaaaac
ttcacagaattgtgggggaagaaagccaaagagctctatggcaacatgtggagcaatttc
agtgacccacagctgaagaaaatcatcggctccatccagaccctggggccctccaacctg
cccctggacaagcggcagcagtacaacaccatcctgagcgacatggacaaaatatactcc
acagccaaggtgtgccttgacaatgggacctgctgggatctggagccagacatctcagac
atcatggccagctcccgcagctacaagaagctcctctacgcctgggagggttggcacaat
gctgcaggcaacccactgcgtgccaagtacgaggagttcgtgacgttgagcaacgaggcg
tatcagatggacggatttgaggacacaggcagctactggcgctcctggtatgactccacc
acctttgaggatgacctggagcatctctacaaccagctggagccactctacctcaacctg
cacgcttttgtccgaagaaagctctatgatcgctatggccccaaatacattaacttgaag
ggccccatccctgctcacctcctcggcaacatgtgggctcagcagtggaataatatctat
gatctaatggtcccctaccctgataagcctaacctggatgtcacaagcaccatggtgaat
cagggctggaatgccacccacatgttccgggtctcggaggagttcttcacttccctggga
ctgctggaaatgccacctgagttctgggacaagtccatgctggagaagccagcagatggc
cgggaagtggtgtgtcatgcctcagcgtgggacttctacaaccgcaaggacttcaggatc
aagcagtgcacaacagtgaccatggagcagctgttcacagtgcaccacgagatgggccac
gtgcagtactacctgcagtacaaggaccagcctgtctccttccgtggtggggccaaccct
ggcttccatgaggccattggtgatgtcatgtccctgtccgtctccacccccagccacctc
cagaaaattgggctcctcagcagtgctgtcgaggatgaagagagcaacatcaactacctg
ctgaagatggctttggagaagattgccttcctgccctttggctacctcatcgaccagtgg
cgctggaatgtgttcaatggccgcacacccccgagccgttacaactacgactggtggtac
ctgagaaccaaataccagggtatttgtgctccagtttcgaggaatgaaagcaactttgac
cccggagcaaagtaccacatccctgggaacaccccttacatcaggtactttgtgagtttc
atcctccagttccagtttcacaaggcgctgtgccaggcggccaaccacaccggtcccctg
cacacctgtgacatctacatgtccaaagaggctggagccaaactcagggaggtgttgaag
gctggatcttccaagtcatggcaggaaatcctgttcaacctcactggcacggataagatg
gatgctggggcgctcctggagtatttcagccctgtcaccacctggttgcaggagcagaac
aacaagaccaacgaggtgctgggctggcctgagtttgactggcgtccccctgtccccgaa
ggctaccctgaaggcatcgataaaatagtagatgaagcacaagctaaagagttcttgtcc
gagtacaacagcacggctgaggtggtgtggaatgcttacactgaggcatcttgggactac
aacaccaacatcactgaccacaacagggaagtcatgctggagaagaacttggccatgtcc
aagcacaccattgagtatggcatgagagccaggcagttcgacccctcggacttccaggac
gaaactgtcacccgcatcctcaataagttgagtgttcttgagagggcagccctgccagag
gatgagctgatggagtacaacaccctcctctcagaaatggagaccacatacagcgtagcc
aaggtctgcagggagaacaacacctgccaccccttggatcctgacctcacggacatcctg
gctacctcacgggactataacgagctcctctttgcctggaagggctggcgggatgcttct
ggggcgaaaatcaaggacaaatacaagagatacgtggaactgagcaacaaggcagctgtg
ctgaatggatacacagacaatggggcttactggagatccctgtatgagacacccaccttt
gaggaagatctggagaggctgtacctgcagctgcagcccctatacctcaacctgcatgcc
tacgtacgtcgagccctgtacaacaaatatggagcagagcacataagcctgaggggtccc
attcctgctcacttgctgggcaacatgtgggcccagtcatggtccaacatcttcgacttg
gtgatgcccttcccagatgccaccaaggtggatgccactccagccatgaaacaacagggc
tggacgcccaagatgatgtttgaggagtcagaccgtttctttacctccctgggcctcatc
cccatgccgcaggagttctgggacaagtccatgattgagaagccagcagatgggcgggag
gtggtgtgtcatgcctcagcctgggacttctacaaccgcaaggacttcaggatcaagcag
tgcaccgtggtgaacatggatgacctaatcacagtgcaccatgagatgggccatgtgcag
tacttcctgcagtacatggaccagcccatctccttccgtgatggagccaaccctggcttc
cacgaggccatcggggatgttatggccttgtctgtttccnacccgaaacacctgcacagc
atcaacctgctggaccaagtgacagaaaatgaagaaagtgacatcaactacctgatgagc
atcgccctggacaaaattgccttcctgccttttggatacctcatggaccagtggcgctgg
aaggtgtttgatgggcggatcaaggaggatgagtacaaccagcagtggtggaacctcagg
ctgaagtaccagggcttgtgttcaccagtaccaaggtctgaagatgactttgacccaggg
gcaaagtttcacatccctgccaacgtcccctacatcaggtactttgtcagcttcgtcatc
cagttccagttccacgaggcgctctgcaaagcagctgggcacacgggacccctgcacaca
tgtgacatctaccagtccaaggaggccgggaagctgctgggagatgccatgaagctgggt
ttcagcaagccatggcctgaagccatgcagctcatcacgggacagcccaacatgtcagca
gaggccctgatgagctactttgagcccctcatgacatggctggtgaaggagaacacaaag
aacggggaggtgctgggctggcccgactacagctggactccttacgcagccaccgaattg
cacgctgccactgacacaactgattttctgggcatgtctgtcggcaccaaacaagccact
gcgggcgcctgggtcctgctggcactggcacttgtcttcctgatcgtctccattttcttg
ggtgtcaagttgttctcatcaaggagaaaggccttcaaatccagctcggaaatggaactg
aaataa

DBGET integrated database retrieval system