KEGG   Meleagris gallopavo (turkey): 100542248Help
Entry
100542248         CDS       T01523                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase E-like
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100542248
Enzymes [BR:mgp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100542248
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core MG2
Motif
Other DBs
NCBI-GeneID: 100542248
NCBI-ProteinID: XP_010720746
LinkDB All DBs
Position
22
AA seq 692 aa AA seqDB search
MGQALTQPSTDWHVKENGRDHHTSKFSTKELIVRRGQAFVITFNGTEQPEQTLTFIAETG
PKPSKQAKTQATFGISSTASKEGWSAVLQSTSSHSVSISISSPANAVIGRYKLSVQSTST
GSSSPVVLGTFVLLFNPWSSGDDVFMPNKAECEEYVLEEFGIIFAGNSNHINSFGWNFGQ
FQADILNICLSMLDRSLNYRKDPATDVSHRYDPKYLGRVLSAMVNANDDQGVVLGNWSGN
YDGGKSPSSWTGSGEILQNWKKSGFKPVRYGQCWVFAAVLTTVLRCLGIPTRTITNFSSA
HDADGNLRVDEFYDASGNHLNEGADSVWNFHVWNESWFSRKDLGPSYSGWQILDATPQEE
SGGIYQCGPASRNAIKEGDVDLDYDCPFVFAEVNADCMYWNYDPATRKKTLLFNKSTVIG
QLISTKAVGRNDRIDVTSDYKYEEGSKKERDIFKKARKKLGLEDKFDPTAPTPKEIEQKP
DISGKFKMAGPLEVGKDLNLILVLTNLQSEVKSVQVNMTAWSTLYTRRPVREIWKDSLSV
SLSPEEEKQFPIKISYAEYQQQLTTDNAIEVTALCHVEGGIQVLVQRHIALDNPAIDIQV
LGEAKVNKEVEVEVVFTNPIDTEVKDCVLQVEGSDLLRGILMIDVPPLKGKEISSTKFKL
TPFETGSKHLLVNFSCDKFADIKAFKTVKVID
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgggccaagctctgacgcagccaagtactgactggcacgtgaaagaaaatgggagagat
caccacacaagtaaattctctaccaaagagttgattgtgaggagaggtcaggcctttgta
attaccttcaatggaacagaacagcctgagcaaaccttaacattcatcgcagaaacaggt
ccaaaaccctccaagcaggccaagacccaagccacatttggtatctccagcacagcaagc
aaggagggctggagcgcagttcttcagtccaccagttcccactctgtgagcatctccatt
tccagcccagctaatgctgtcattggacgttacaagctgagcgttcaaagtacttcaact
ggcagctcgtctccagtagtccttggcacttttgttttgctcttcaacccttggtcttca
ggtgatgatgtgttcatgcctaacaaggctgagtgtgaggaatatgtgctagaagagttt
ggtatcatttttgctggcaacagtaatcatatcaacagctttggatggaactttggccag
tttcaagcagacatcctcaatatttgcctttccatgctggatcgaagcttgaactaccgt
aaggatcctgccacagatgtatctcaccgatacgatcccaaatatctgggccgtgttctc
agcgcaatggtcaatgccaatgatgaccaaggagtggtactaggaaactggagtggaaat
tatgatggtgggaaaagtccaagcagctggactggaagtggtgaaatcctgcaaaactgg
aagaaatcaggattcaagcctgttagatatggacagtgttgggtttttgcagcagtatta
actacagtgcttagatgtctggggattcccactcgtacaattacaaacttcagctctgcc
cacgatgcggatggaaatctgcgtgtggatgagttttatgatgcttctggaaatcatttg
aacgagggagctgacagtgtctggaatttccatgtctggaatgaaagctggttttcccgc
aaggacttgggtccttcatacagcggatggcaaattctggatgcaactccccaagaagaa
agtggaggaatttatcagtgtggtcctgcctcaaggaatgccatcaaagaaggagacgta
gatctggactacgactgtccatttgtatttgcagaagtgaatgcagactgtatgtactgg
aattatgatcctgcaactagaaagaaaacattattattcaacaagtcgacagtaatcggc
caactcatcagcacaaaggcagttggtagaaatgatcgtatagatgtcaccagtgattat
aaatatgaagaaggctctaaaaaagaaagagatatttttaaaaaagcccgtaagaagctg
ggactggaggataaatttgatcctacagcaccaacaccaaaggaaattgaacaaaagcct
gatatctcaggaaagtttaagatggctggtcctttagaagtcggcaaagacctcaattta
attctggttctcacaaatttacaatctgaagttaaatctgttcaagtaaatatgactgca
tggagcactctgtatacaagaagaccagttcgtgagatctggaaggactccctatctgtc
tctctgtctcctgaggaagagaaacaatttcccattaagatatcttatgctgaatatcaa
cagcagttaactacagataacgcaattgaggtaacagctttatgtcacgtagaaggtggg
attcaagtactggtgcaaagacacattgccctggacaaccctgccattgacatacaggta
cttggtgaggcaaaagtgaataaagaagtggaagtggaagtggtatttaccaatcctatt
gataccgaagtgaaggactgtgtgctgcaggtagaaggcagtgacctgctgagaggaatc
cttatgatagacgtaccaccactgaaaggcaaagagatatccagtacaaaatttaaactt
accccttttgagacgggctccaagcatctgcttgttaatttctcctgtgataaatttgca
gatatcaaggcctttaaaactgtaaaggtgattgactaa

DBGET integrated database retrieval system