KEGG   Meleagris gallopavo (turkey): 100542303
Entry
100542303         CDS       T01523                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04010  MAPK signaling pathway
mgp04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100542303 (TGFA)
   04012 ErbB signaling pathway
    100542303 (TGFA)
SSDB
Motif
Pfam: DUF1180 DAG1
Other DBs
NCBI-GeneID: 100542303
NCBI-ProteinID: XP_010721484
Ensembl: ENSMGAG00000007794
LinkDB
Position
24
AA seq 181 aa
MAQLPPFPFNSGSSREVLGLFSLPALALSPVRLPAGMLVAVCHALENTTSVLSDPPVAAA
VRSHFNECPDSHRQFCFHGTCRFLVQEDKPACVCHSGYVGTRCEHADLLAVVAANQKKQT
ITALLVVAVVASAVLIAACVLIHCCRLRKRCGCCRVPLCGQEKPSGLLKGGASCCHTESV
V
NT seq 546 nt   +upstreamnt  +downstreamnt
atggcacagctgcccccgttcccttttaactcagggtcttcacgagaggttttagggctt
ttctctcttcctgcgttggctctgagccctgtccgtctgcccgcaggcatgctggtggct
gtgtgccatgccctggagaacacaacgtcagtgctgagcgatcccccagtggcagcagcc
gtgcggtcacacttcaatgagtgccccgactcccaccggcagttctgcttccatgggacg
tgccgcttcctggtgcaggaggacaagccggcgtgtgtgtgccactcgggctacgtgggg
acgcgctgtgagcacgcagacctgctggccgtggtggctgccaaccagaagaagcagacg
atcaccgcgctgctggtggtggccgtggtggcctcagcggtgctgatcgcagcctgcgtg
ctcatccactgctgccggctgcggaagcgctgcgggtgctgccgggtgccgctctgcggg
caggagaaaccatcggggctgctgaagggtggagcgtcctgctgccatactgagagtgtt
gtctga

DBGET integrated database retrieval system