KEGG   Meleagris gallopavo (turkey): 100542346Help
Entry
100542346         CDS       T01523                                 

Gene name
SETDB1
Definition
(RefSeq) SET domain bifurcated 1
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100542346 (SETDB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mgp03036]
    100542346 (SETDB1)
Enzymes [BR:mgp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100542346 (SETDB1)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100542346 (SETDB1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100542346 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF5604 SET Tudor_4 TUDOR_5 Pre-SET MBD DUF4537
Motif
Other DBs
NCBI-GeneID: 100542346
NCBI-ProteinID: XP_010722271
Ensembl: ENSMGAG00000001018
LinkDB All DBs
Position
27
AA seq 1283 aa AA seqDB search
MERSSGGDKRWTHPSVVPGGAEMDCQDIKELQKEVMEEMGISMEELEDIINKELEKSEYV
KQKKQQLEELEMYVKQKEEEVAHVDRLFDDAWRDFHKCEMLVKDLYSKLGLEYRESSSEE
EDLAAKPTEVIEIPDDDDDDIMSVDSGWKNSDSSPKVPKDQTLLREAMAAMRRSAQDVQK
FMDAVHRRTNAQDAVKDAQTPQQAPGALQSAGPAVGVGDLSNDGDLKVGMRILGKKRTKT
WHKGTLIAIQTVGAGKKYKVKFDNKGKSLLSGNHIAYDYHPSPDKHYVGSRVVAKYKDGD
QVWLYAGIVAETPNVKNKDRFLIFFDDGYASYVKEWELYPVCRPLKKTWEDIEDVSCRDF
IEEYISAYPNRPMVLLKNGQLIKTEWEGTWWKSRVEEVDSSLVKILFLDDKRCEWIYRGS
TRLEPMFSMKTSTASTQEKKQSGQARTRPNVGAVRSKGPVVQYTQDLTGAGTQYRALEQM
QSASLAAQPASPQPSEVECSDGLLAQSRKQVAKKSTSFRPGSGQSSPSPPVLSDAPGRAA
AAQQHRFPSGPAGSAQPFHGMLDRVPNEPSYRAPLEKLFYLPHVCSYACLSRVRPIRSDQ
YRSKNPLLIPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRSMAEIERYLFETDCDFL
FLEMFCLDPYVLVDRKFQPYKPYYYIADITKGREDVPLSCVNEIDGTPPPQVAYSKERIP
GKGVFINTGWEFLVGCDCRDGCRDKSKCACHQLTVQATGCTPGGQINPNSGYQHKRLEEC
LPTGVYECNKRCKCNVNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYA
GKILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESDAKCSSDSSGVDLKDDEEDNT
GTEEQEESNEDSSDDNFCKDEGFNASSVWRSYATRRQTRGQKENGLSETASKDSGLTPQV
GHDEAAAAASCKLPVSEETCKNKVASWLSSNSVSDSFQDNDSTSSFKMSEGGEAKGCRAD
PAPGGAEGEAKAPRKDEPEDSSKVLGLSDLGRLYGYNPSPPKLDGVRRPTSKTALLQSRR
HSGPLQPPAEDVLTLSSSTDSDGDNGPKVEGQPQGAANDSDDIQTISSGSEEEEGDEKKN
PSGSGPMKRQVAVKSTRGFALKSTHGIAIKSTNMAAAEKGDSAPVCRTTRQFYDGEESCY
IIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNYE
VGSVEGKELLCCCGAIECRGRLL
NT seq 3852 nt NT seq  +upstreamnt  +downstreamnt
atggagcggagcagtgggggggacaaacggtggactcacccctctgtggttccgggtgga
gcagaaatggattgccaggacatcaaagagctgcaaaaagaagtgatggaggagatggga
atctccatggaggagctggaggacatcatcaacaaggagctggagaagtctgagtacgtg
aagcagaagaagcagcagctggaggagctggagatgtacgtgaaacagaaggaagaggag
gtggctcacgtcgatcgtctctttgatgatgcttggagagactttcataaatgtgagatg
ttggtaaaggatctgtactccaagctgggcctggagtaccgtgagagcagctctgaggag
gaggacttggctgccaaacccacagaagtgattgagatcccggacgacgacgatgacgac
atcatgagtgtggattcggggtggaagaacagtgatagcagtcccaaggttcccaaggat
cagactctgctgagggaagccatggcagcaatgagaaggtcagcccaggacgttcagaaa
tttatggatgctgtgcacaggagaacaaacgcccaggatgcggtgaaagatgcacaaacc
cctcagcaagctcctggtgctctccagtctgctggacctgctgtgggggtgggtgatctc
agcaatgatggtgatctgaaggttggcatgaggatcctgggcaagaagagaaccaaaacg
tggcacaaagggactctgattgccatccagactgtcggtgctggtaagaagtacaaagtg
aagtttgacaataaggggaagagtttgctttctggcaatcacatcgcttacgactatcac
ccctccccggacaaacactacgttgggagcagagttgtggcaaaatacaaagatggggat
caggtttggctgtatgctggcatagtggctgaaacaccaaacgtgaagaacaaagacagg
ttcttgatcttctttgatgatggctacgcttcgtacgtcaaggagtgggagctgtaccca
gtctgcaggccgcttaagaagacgtgggaggacatagaggacgtgtcgtgccgggacttc
atcgaggagtacatcagtgcttaccccaaccggcccatggtgctgctgaagaacggccag
ctgatcaaaaccgagtgggaggggacctggtggaaatccagggtggaagaggtggacagc
agtctggtcaaaatcctcttcctggatgacaaacgctgtgagtggatttaccggggatcc
acgcgcctcgagcccatgttcagcatgaaaacctccactgcctccacccaggaaaagaag
cagagtggacaggcaaggactcgtcccaacgttggcgctgtgcggagcaaaggccccgtc
gtgcagtatacacaagatctgactggagctggaacccagtacagagccctggagcagatg
cagtcagcctcgctggcagcacagcccgcttctccgcagccctctgaggtggagtgctct
gatggtctgctggcccagtcgaggaagcaggtggccaagaagagcacatccttccggccc
ggatcggggcagtcgtcgccttcaccgcccgtgctgagcgatgcaccaggaagagcggct
gcagcccagcagcaccgcttccccagcgggccggccggctcagcgcagcccttccacggc
atgctggaccgggtgcccaacgagccgtcgtaccgcgcgccgctggagaagctcttctac
ctcccccacgtctgcagctacgcctgcctgtcccgcgtgcggcccatccgcagcgatcag
taccgcagcaagaaccccctgctcatccctctgctctacgacttcaggaggatgacggcc
cgccgcagggtgaaccgcaagatgggtttccacgtcatctacaagacgccgtgcgggctc
tgcctgcgcagcatggccgagatcgagcgctacctcttcgagaccgactgcgacttcctc
ttcctggagatgttctgcctggatccctacgtcctggtggatcgcaaattccagccctac
aagccctactattacatcgccgacatcaccaagggccgcgaggacgtgccgctgtcctgc
gtcaacgagatcgacggcacgccgccgccgcaggtggcctacagcaaggagcgcatcccc
ggcaagggggtcttcatcaacacgggctgggagttcctcgtgggctgcgactgcagggac
ggctgcagggacaaatctaagtgtgcctgtcaccagctgacggtccaagcgaccggctgc
accccgggagggcagatcaaccccaactcggggtaccagcacaagaggctggaggagtgc
ctcccaactggggtttacgagtgtaacaagaggtgcaaatgcaacgtcaacatgtgcacc
aaccgcctggtccagcacgggctgcaggtcaggctgcagctgttcaagactcagaacaag
ggctggggcatccgctgcctcgatgacattgccaagggctccttcgtctgcatctatgca
gggaaaatcctcacggatgacttcgccgacaaagagggcttggagatgggggatgagtac
tttgcaaacctggatcacatcgagagcgtggagaacttcaaggagggctacgagagcgac
gccaagtgctcgtccgacagcagcggggtggacctgaaggacgacgaggaggacaacacg
ggcacggaggagcaggaggagtccaacgaggacagctctgatgacaacttctgcaaggac
gagggcttcaacgccagctcggtgtggcgcagctacgccacgaggcgacagacccgcggc
cagaaggagaacggcctctcggaaacggcctccaaggactcggggctcacaccgcaggtc
ggccacgatgaggctgcagcagctgcctcctgcaagctgcccgtgtccgaggagacctgc
aagaacaaagtggcctcgtggctcagctccaacagcgtgtctgacagcttccaggacaac
gacagcacctcgtccttcaagatgagcgaaggaggggaggccaaaggctgcagggctgat
cctgcgccggggggagcggagggagaggcaaaggcaccaaggaaggatgaacctgaagat
tcaagcaaagtcctggggctcagcgacctgggcaggctgtacggctacaaccccagcccc
cccaaactggatggggtgcgaagacccaccagcaaaacggctctgctgcagagcaggcgg
cactcggggcccctgcagccccccgccgaggacgtgctgaccctgtccagcagcaccgac
agcgatggggacaacgggcccaaggtggaggggcagccccagggtgctgccaacgacagc
gacgacatccagaccatctcatcgggctctgaggaggaggaaggggacgagaagaagaac
ccctctggttcagggcccatgaagaggcaggtggcagtgaaatccacgcgggggtttgcc
ctgaaatccacccacggcatcgccatcaaatccaccaacatggcagcagccgagaagggc
gacagcgctccggtctgcaggacgacacggcagttctatgatggagaggagtcctgctat
atcatcgatgccaaactggaggggaacctgggccgctacctcaaccacagctgcagtccc
aacctcttcgtgcagaacgtttttgtggacacgcacgacctgcgcttcccatgggtcgcc
ttcttcgccagcaagaggatccgggcgggcacggagctgacgtgggattacaactacgag
gtgggcagcgtggagggcaaagagctgctgtgctgctgcggggccatcgagtgcagaggg
aggctgctgtga

DBGET integrated database retrieval system