KEGG   Meleagris gallopavo (turkey): 100542373
Entry
100542373         CDS       T01523                                 

Gene name
THBS1
Definition
(RefSeq) thrombospondin-1
  KO
K16857  thrombospondin 1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
mgp04145  Phagosome
mgp04350  TGF-beta signaling pathway
mgp04510  Focal adhesion
mgp04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100542373 (THBS1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100542373 (THBS1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100542373 (THBS1)
  09143 Cell growth and death
   04115 p53 signaling pathway
    100542373 (THBS1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100542373 (THBS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mgp04131]
    100542373 (THBS1)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mgp00536]
    100542373 (THBS1)
   04990 Domain-containing proteins not elsewhere classified [BR:mgp04990]
    100542373 (THBS1)
Membrane trafficking [BR:mgp04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100542373 (THBS1)
Glycosaminoglycan binding proteins [BR:mgp00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   100542373 (THBS1)
Domain-containing proteins not elsewhere classified [BR:mgp04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   100542373 (THBS1)
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC EGF_3 EGF_CA TSP1_ADAMTS cEGF TSP1_CCN Laminin_G_3 EGF Laminin_G_2
Other DBs
NCBI-GeneID: 100542373
NCBI-ProteinID: XP_010709922
Ensembl: ENSMGAG00000012054
LinkDB
Position
5
AA seq 1180 aa
MLAMGPAAGLVLLLLALGSPEAKRTAESRGDDDNVFDVFEHLNLNRNGAGRRAPGVHLVK
GPESSSPAYRIEDASRIPAVPDSKFQDLLDIIHAEKGFILLATLRQAKKSRGTLLSVERK
DGSGHVFSLVSNGKAGTLDLSLSGDGKQQLVSVEDALLATGHWKNITLFVQEDRAQLYVG
CEKMENAELDIPIQKIFSRGLASSARLRIAKGGVNDNFQGLLQNVRFVFGTTPETILRNK
GCSSSTSAIITLDNPINGSSPAIRTNYIGHKTKDIQAVCGFSCDELTNMFVELQGLRSMV
TTLQDRVRKVTEENELIAKVVQITPGVCIHNGILHKNKEEWTIDSCTECTCQNSATICRK
VSCPLMPCSNATVPDGECCPRCWPSDYADDGWSPWSEWTSCSVTCGNGIQQRGRSCDSLN
NRCEGSSVQTRTCHLQECDKRFKQDGGWSHWSPWSSCSVTCGTGMITRIRLCNSPVPQLN
GKPCEGEARETKPCQKDPCPINGNWGPWSPWDACTVTCGGGLQKRSRLCNNPEPQYGGKT
CVGEAKGTQVCNKQDCPVDGCLSNPCFAGTTCTSSPDGSWKCGACPAGYHGDGIHCQDID
ECKEVPDACFVFNGEHRCENTEPGYNCLPCPPRFTGSQPFGRSVEDAMANKQVCKPRNPC
TDGTHDCNKNAKCNYLGHFSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANAT
YHCKKDNCPNLPNSGQEDYDKDGIGDACDNDDDDDGISDDRDNCPFIYNPQQYDYDRDDV
GDRCDNCPYNHNPDQIDTDNNGEGDACAVDIDGDGVLNERDNCQYVYNVDQRDTDLDGVG
DQCDNCPLEHNPDQEDTDSDRIGDECDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGK
GDACDHDDDNDGIPDDKDNCRLVANPDQADSDGDGRGDACKDDFDQDSVPDIDDICPENV
EISETDFRRFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGFDEFNAVDFSG
TFFINTERDDDYAGFVFAYQSSSRFYVVMWKQITQSYWDSTPTKAQGYSGLSIKVVNSTT
GPGEHLRNALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGYIRVVMYEGKK
IMADSGPIYDKTYAGGRLGLFVFSQEMVFFSDLKYECRDP
NT seq 3543 nt   +upstreamnt  +downstreamnt
atgctcgccatggggccagccgctggtctcgttctccttctcctggcgctcggcagcccg
gaagccaaacgcacggcagagtccaggggtgatgatgacaacgtctttgatgtctttgaa
caccttaacttgaatcgcaacggagctgggcgccgggcacctggggtgcatctggtgaag
gggccggagtcctccagccctgcttaccgcattgaagatgccagtcgtatccctgctgtc
cctgactccaagttccaagacttgttagatatcatccatgctgagaagggcttcatcctt
ctggccactctccggcaagccaagaagagcagaggcacactgctgtctgtggaacggaaa
gacggctctggtcatgtcttcagtctagtttcaaatggcaaggcaggcaccttggacctg
agcctctctggtgatggcaagcagcagttagtgtctgtagaggatgctttgttagctaca
ggacactggaagaacatcaccttgtttgtgcaagaagaccgggctcagctttatgtgggg
tgtgagaaaatggagaatgctgaactggacattcccattcaaaagattttcagcaggggc
ctggccagcagtgccaggcttcgtattgccaaagggggagtcaatgacaacttccaggga
ctgttgcagaacgtacggttcgtgtttggaacaactccggaaactattctgaggaacaaa
ggctgctccagctctactagtgcaatcattactttggacaaccccataaatggttccagc
ccagctatccgcaccaactacattggccataaaacaaaggacattcaagcagtctgtggc
ttttcctgtgatgaactaactaacatgtttgtagaactgcaagggctacggtccatggtt
acaacacttcaagacagagttcgcaaagtgactgaagaaaatgaactgattgccaaagtg
gtccagatcactcctggagtatgcattcataatgggatcttgcacaaaaataaggaagag
tggactattgacagctgcactgaatgtacttgccagaactctgccactatatgccggaaa
gtgtcttgccctctcatgccttgttccaatgccactgtgcctgatggggagtgctgcccc
cgatgctggcctagcgactatgcagatgatggatggtctccttggtctgaatggacttca
tgttcagtgacctgtgggaatggaattcagcagagagggcgttcctgtgacagcctcaac
aaccgctgtgaagggtcttctgtgcagactcggacttgccaccttcaagagtgtgataag
agatttaaacaagatggtggttggagccactggtcaccgtggtcatcatgttcagtcacc
tgtggtacaggcatgatcactagaattcgtctctgcaactctccagtaccacagctgaat
ggcaagccttgtgagggtgaagcaagagaaaccaagccctgccagaaagatccttgccca
attaacggcaactggggaccatggtctccatgggatgcttgcacagtgacatgtggagga
ggacttcagaaacgcagccgtctctgcaataatcccgagcctcaatatggtgggaagact
tgtgtaggtgaagctaaaggaactcaggtctgcaacaaacaggactgtccagttgatggg
tgtctgtctaatccctgctttgcgggaactacgtgtacaagctcccctgatggttcttgg
aagtgcggtgcctgtcctgctggctaccatggcgatggtatccactgccaagatattgat
gagtgcaaagaagttcctgatgcctgctttgtcttcaatggagaacacaggtgtgagaat
actgaacctggatacaactgtctgccttgtccaccacgtttcactgggtcacagccattt
ggtcgcagtgttgaggatgccatggcaaacaaacaggtctgcaagccacgtaatccatgc
acagatggaacacacgattgcaacaagaatgccaaatgcaattaccttggccacttcagt
gacccgatgtatcgttgtgaatgtaaaccaggctatgctggcaatggcataatctgtgga
gaagatactgacttggatggatggccaaatgagaaccttgtctgtgttgccaatgccact
taccactgtaaaaaagataactgccccaatctccccaactctgggcaggaagactatgat
aaagatgggattggtgatgcctgtgataatgatgatgacgatgatggtatttctgatgac
cgggacaactgcccattcatctacaacccacagcagtatgactatgacagggatgatgtt
ggtgaccgttgtgataactgcccctacaatcacaaccctgatcagattgacactgacaac
aatggagaaggagatgcatgtgcagtggatattgatggagatggggtcctcaatgaaagg
gacaactgccaatatgtctacaatgtagaccagagggacacagacttggacggtgttgga
gatcagtgtgataactgtccactggaacataatcctgaccaggaagatactgactctgac
cgtataggtgatgagtgtgacaacaaccaggacatagatgaagatggtcatcaaaataat
cttgataactgcccttatgtgcccaatgccaatcaagctgatcatgacaaggatggaaaa
ggtgatgcctgtgaccatgatgatgacaatgatggtattcctgatgacaaagataactgc
agattagttgccaacccggatcaagcggattctgatggtgatggacgtggagatgcttgc
aaagatgactttgaccaagacagtgtgccagacattgatgacatctgtcccgaaaatgtg
gaaatcagtgagactgacttccgaaggtttcaaatgattcccttggatccaaaaggaaca
tcccaaaatgatccaaactgggttgtacgtcaccagggtaaagaactggttcagacagtc
aactgtgaccctggccttgcagttggttttgatgaattcaatgctgtggacttcagtggc
accttctttatcaatacagaaagggatgatgattatgctggctttgtatttgcctaccaa
tctagcagtcgtttttacgttgtcatgtggaagcagattactcagtcttactgggactcc
acaccaaccaaagctcaaggctactcaggtctctccatcaaggttgtgaattccaccaca
ggtccaggagaacaccttcgtaatgctctgtggcacacaggaaacacacctggccaggtg
agaactttgtggcatgaccctcgtcacataggctggaaagacttcactgcatacagatgg
cgccttagccatagaccaaagactggctacatcagagttgtaatgtatgaagggaagaaa
atcatggcagactcaggaccaatctatgataaaacttatgctggtggtcgtctaggatta
tttgttttctctcaagaaatggtgttcttctcagatcttaaatatgaatgcagagatcca
taa

DBGET integrated database retrieval system