KEGG   Meleagris gallopavo (turkey): 100542390
Entry
100542390         CDS       T01523                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1
  KO
K09850  Ras association domain-containing protein 1
Organism
mgp  Meleagris gallopavo (turkey)
SSDB
Motif
Pfam: RA Y_phosphatase
Other DBs
NCBI-GeneID: 100542390
NCBI-ProteinID: XP_010716621
Ensembl: ENSMGAG00000001450
LinkDB
Position
14
AA seq 237 aa
MYSSTPFPGEAASTERLTKLLLPAWPRPAARGRQVLGVWRELEKRDKRVNSVCVHCVVGA
SKTRKFPSGYCSQEDSDSEPELFYTARTSFGRRPRRRQDEPSSWETAELDPAQVEQRIKE
YNSQINSNLFMSLNKDGSYTGFIKVQLKLARPVSVPAAKRGPGGRSGQRAAGVKRRTSFY
LPRGTVKHLHVFSHTRASEVISALLRKFTVVDDPRKFALFERSENDEQGRAGVVASP
NT seq 714 nt   +upstreamnt  +downstreamnt
atgtattcttccaccccttttcccggcgaggcagcaagcactgagcgcctcaccaagctg
cttctcccagcctggccccgtcctgctgcgcggggcaggcaggtcctgggcgtctggagg
gagctggagaaacgtgacaaacgtgtaaatagtgtctgtgtccactgtgtcgttggagca
agcaaaacgaggaagtttcccagcggctactgcagccaggaggactccgactccgagccc
gagctcttctacaccgcccgcacctccttcggtcgccgcccgcgtcgtcgccaggatgag
cccagcagctgggagacggcggagctggacccggcacaggtggagcaacgcatcaaggag
tacaacagccagatcaacagcaacctcttcatgagcctgaacaaggatggctcctacact
ggcttcatcaaggtgcagctgaagctagcgcgccccgtctctgtgccagctgctaagcgg
ggccctggggggcggtcggggcagcgcgcggcgggcgtgaagcgccgcacatccttctac
ctgccccgcggcaccgtcaaacacctgcacgtgttctcacacacccgcgccagcgaggtg
atcagcgcgctgctccgcaagttcaccgtggtggacgatccccgcaagtttgccctcttc
gagagatccgaaaatgatgagcaaggtagagctggggtggtggcatccccatag

DBGET integrated database retrieval system