KEGG   Meleagris gallopavo (turkey): 100542484
Entry
100542484         CDS       T01523                                 

Gene name
ATR
Definition
(RefSeq) serine/threonine-protein kinase ATR
  KO
K06640  serine/threonine-protein kinase ATR [EC:2.7.11.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03460  Fanconi anemia pathway
mgp04110  Cell cycle
mgp04115  p53 signaling pathway
mgp04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    100542484 (ATR)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100542484 (ATR)
   04115 p53 signaling pathway
    100542484 (ATR)
   04218 Cellular senescence
    100542484 (ATR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mgp01001]
    100542484 (ATR)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100542484 (ATR)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100542484 (ATR)
Protein kinases [BR:mgp01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100542484 (ATR)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100542484 (ATR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase UME Mad3_BUB1_I HEAT TRIF-NTD
Other DBs
NCBI-GeneID: 100542484
NCBI-ProteinID: XP_010714950
Ensembl: ENSMGAG00000006227
LinkDB
Position
11
AA seq 1754 aa
FSFLTNPYCIAFIENVPHLCKHLDFNNDESSVKVLIGSLLNLMEDPDKDVRVALSDCIKN
ILESLDSEEGFIKELFVSRMKEAYTHAKISRNNELKDTLILTTGDIGRASKGDLVPFALL
HLLHCLLSKSASVAGAAYTEIRSLAVAKSIKLQAFFSQYKKPICQFLVESLHSSQMTVLS
APCQGNELHKQEAAHQREMALDMLSEVANVFDFPDLNRFLSRTLQVLLPDLAAKASPAAS
ILIRTIAKQLNVNRREILINNFKYIFSHLVCSCSKDELERALHYLKNETEIELGSLLRQD
YQGLHNELLLRIGEHYQQVFNGLSILASFASHDDPYQGPREITSPEQMADYLQPKLLGIL
AFFNMQLLSSSVGIEDKKMALNSLMSLMKLMGPKHISSVRVKMMTTLRTALRYKDDFPEL
CCRAWDCFVRSLDHSYLGSLLSHVIVALLPLIHIQPKETTAVFYFLIVENRDTVRDFLHE
IYFLPDLPELKEIQVVLQEYRKESSKSTDLQTTLQLSMRAIQHENVDVRIHALTSLKETL
YRNQEKLVKYVTDSETVEPVISQLVTVLLIGCQDANSHARLLCGECLGELGAIDPGRLDF
STSETQGKDFTFVAGVEDLNFAYGLLMELTRAFLAYADNVRAQDSAAYAIQELLSIYDCR
ETNSDCPGSRLWRRFPEHVQEILEPHLNTRYKSYQKAIDWSKVKKPIYLSKLGDNFAEWS
ATWAGYLITKVRHDLARKVFDCCSIMMKNDYKVTIYLLPHILVYVLLGCSQEDQQEVYME
IMAVLKHDDQCSRRLQDSASDLSQLSTQTVFSMLDHLTQWARHKFQMLIAEKNTSKSSKD
RNDLKTSSEDYGEYQNVTRFLDLIPQDTLAVASFRSKAYTRAVMHFESFITEKKQNIQEH
LGFLQKLYAAMHEPDGVAGVSAIRKAEPSLKEQILEHESIGLLRDATACYDRAIQLEPDQ
IIHYHGVVKSMLGLGQLSTVITQVNGVLANRSEWVSELNTYRVEAAWKLSQWDLLENYLA
SDVKSTAWSVRLGHLLLSAKKKNEVAFYETLKVVRAEQIVPLSAASFERGSYQRGYEHII
RLHMLCELEHSIGPMFQQPDGEHSRDSLNWCARIEMTQNSYRAKEPILALRRALLSLSKS
QDYSELVGQCWLQSARVARKAGHHQTAYNALLNAGESTLSELYIERAKWLWSKGEVHQAL
IVLQKGVELCFPENKAPCNTKNQLVHGRAMLLVGRFMEETANFESNAVMKKYKDVTLLLP
EWEDGHFYLAKYYDKLMPMVTDNKMEKQGDLIRYIVHHFGRSLQYGNQFIYQSMPRMLSL
WLDFGAKAYECDKASRSERIQMKNDLAKINKVITEHTNQLAPYQFLTAFSQLISRICHSH
DEVFAVLMVIVAKVFLAYPQQAMWMMTAVSKSSYPMRVNRCKEILNKAINMKESLGKFIG
DATRLTDKLLELCNKPVDGNSSALSMNIHFRTLKRLVEEHTFSQILIPLQSVMIPTLPSI
PGTHANHDPFPGCWAYIAGFDDTVEILASLQKPKKITLKGSDGKSYIMMCKPKDDLRKDC
RLMEFNSLINKCLRKDAESRRRELHIRTYAVIPLNDECGIIEWVNNTAGLRNILIKLYKE
KGIYMTGKELRQHMLPKSAPLSEKLKMFKEVLLPRHPPVFHEWFLRTFPDPTSWYNSRSA
YCRSVAVMSMVGYILGLGDRHGENILFDSLTGECVHVDFNCLFNKVRNGILLHLLYILLA
CNFVNIYNCFLFFF
NT seq 5265 nt   +upstreamnt  +downstreamnt
ttttctttcctcaccaacccatactgcatagcatttatagaaaacgttcctcacctttgc
aaacatctggattttaacaatgatgagtcaagtgtgaaggttctcattgggtctttatta
aatctaatggaagatccagacaaagatgtacgagttgctctcagtgactgcataaagaac
atattagaatccttagactctgaagaaggattcataaaagagctctttgtttcaagaatg
aaagaagcctatacacatgccaaaatatcaagaaataatgagcttaaagataccttgatt
ctcacaacaggagatattggaagggcatcaaaaggagatttggtaccatttgccctcttg
catttgttgcattgtttgttgtccaagtcagcttctgtggctggagcagcttacacagaa
attcggtccctggcagtagctaagtccataaaactacaagcttttttcagtcagtacaag
aaacctatctgtcagtttctagtggaatccctgcactccagccagatgacagtattgagt
gctccatgccagggtaatgagctgcacaaacaagaagctgctcaccagagagaaatggct
ctggacatgttgtctgaagttgctaatgtatttgactttccagatctaaatcgctttttg
tcacggactctgcaagttttgctgcctgaccttgcagccaaggccagtcctgcagcctcc
atccttattcgaaccatagcaaaacaactgaacgtaaaccgaagagagattttaatcaac
aacttcaaatacatcttctctcatttggtctgttcctgctctaaggatgaacttgagcgg
gcacttcattacctcaagaatgagactgagatcgaactgggcagcttgttgagacaggac
taccagggactgcataatgaattattgctacgtataggagagcactatcagcaagtattc
aatggtttgtcaatattggcttcatttgcatctcatgatgatccctatcagggacctagg
gaaataacgtcacctgagcaaatggctgattatctgcagcctaaattgcttggtatcttg
gccttttttaacatgcagttattgagttctagtgtgggcattgaggataaaaaaatggcc
ttaaacagtcttatgtctttaatgaagcttatgggtcccaaacacatcagttcagtacga
gtgaagatgatgactactctgagaacagctctaagatacaaggacgactttccagaactg
tgttgcagggcctgggactgttttgttcgaagtctggatcattcataccttggctccttg
cttagtcatgtgatagtagctttgctgcctctaatacatatccagccaaaggaaactaca
gcagtattttactttctcatagttgagaacagggatacagtacgggacttcttacatgag
atatattttctgcctgaccttccggaactaaaggaaattcaagtagtccttcaggaatat
cgaaaggaatcctccaaaagcactgacttgcagacgacgctgcagctgtccatgagagct
attcagcatgagaatgtggatgttcgtatccatgcacttaccagcctgaaagaaacgtta
tatagaaatcaggaaaaattggtgaagtatgtaacagacagtgaaaccgtagagccagtc
atctctcagttggtaactgtacttctgattggctgtcaggatgcaaattctcatgcccgg
ctactttgtggggaatgtttaggtgaactgggagccatagaccctggcaggctggatttt
tcaacgagtgaaactcaaggaaaagattttacatttgtggctggtgtggaggatctgaat
tttgcctatggattactgatggaactgactagagcatttcttgcttatgctgataatgtt
cgtgctcaggattctgctgcatatgccattcaggagttactgtctatttatgactgtaga
gagacaaacagtgactgcccaggctccaggctttggaggagatttcctgagcatgtgcag
gaaatcttggaacctcacttaaatacacggtacaagagttatcaaaaggctatagattgg
tcaaaggtgaagaagcctatttacctaagcaaattaggtgacaattttgcagaatggtca
gcaacttgggcaggttaccttataacaaaggtacgacatgatctcgccagaaaagttttt
gattgctgcagtattatgatgaagaatgactataaagtgacaatttatctgctaccacac
atccttgtttatgttttgttgggatgcagtcaggaggaccaacaagaggtttacatggag
attatggctgttctgaaacatgatgatcagtgtagcaggagacttcaagacagtgcatct
gatctaagccagctgagcacgcagacagtgttctccatgcttgatcatctaactcagtgg
gctagacacaagtttcagatgcttattgctgaaaaaaatactagcaagtctagcaaagac
agaaatgacctaaaaacttcaagcgaggactatggagagtatcagaacgtgacacgcttt
ttagacctgatacctcaagatacactggctgtggcttcttttcgctcgaaggcttacaca
agggctgtgatgcattttgagtcattcatcacagagaaaaagcaaaacattcaggagcat
cttggatttctgcagaaattgtatgctgcaatgcatgagccagatggagtggctggagtg
agtgcaattcggaaagcagaaccatctctcaaagagcaaatcctcgaacatgaaagtatt
ggcttgttaagagatgccacagcctgttatgatagggctatccaactagaacctgatcag
attattcattaccatggtgtagtgaagtccatgttaggccttggtcaattatctactgta
attactcaagtgaatggagtacttgcaaacaggtctgaatgggtttctgaattgaacaca
tacagagttgaagcagcctggaaactgtcacagtgggatttactggagaattatttggct
tcagatgtgaagtccactgcttggagtgtcagattaggacatttattactatcggccaag
aagaaaaatgaagtcgcattttatgaaacgctcaaggttgttcgagcagaacagattgtg
cccctttcagcagcgagctttgaaagaggatcctatcagcgaggatatgagcacattatc
aggttgcatatgctctgtgagttggaacatagtattggaccaatgtttcagcaaccagat
ggtgaacacagtagagattccctgaattggtgtgctcgtattgaaatgacccagaactct
tacagagcgaaagaacctattctagcactaagaagggctttgcttagtcttagtaaaagc
caggattacagtgagcttgttggtcagtgttggctccagagtgctagagttgcaagaaaa
gctggtcatcatcagactgcatataatgctcttctgaatgctggggaatctacactctca
gaactttatatagaaagagcaaagtggctctggtccaagggtgaggttcaccaagcactt
attgttctccagaaaggagtggagctatgtttccctgagaataaagcgccatgtaatacc
aaaaatcagctcgtccatggtcgggcaatgctgctagttggtagatttatggaagaaact
gctaactttgaaagcaatgcagttatgaaaaagtataaggatgttacacttttgttgcca
gaatgggaagatggacatttttatcttgctaaatactatgataaattaatgccaatggta
actgacaataagatggaaaaacaaggagatctgattagatacatagttcatcattttggg
aggtctctacagtatggaaaccaatttatctatcagtcaatgccaagaatgctatcttta
tggttggactttggagcaaaagcatatgagtgtgataaagcaagtcgttcggaacgcatt
caaatgaaaaatgatttggctaaaataaataaagtgattacagagcacacaaatcagcta
gcaccttatcagtttctgacagctttttctcagttaatctcccgaatctgccattctcat
gatgaagtctttgctgttctgatggtgattgttgctaaggtgtttctggcctacccacag
caagcaatgtggatgatgactgctgtgtctaagtcttcgtaccctatgcgtgtcaataga
tgcaaggaaatactaaataaagctatcaacatgaaggagtccttaggaaaatttattgga
gatgcaacacgccttacggataaactcttagaactgtgcaacaaaccggttgatggaaac
agctcagcattaagcatgaatattcatttcagaacacttaagagattggtagaagagcac
acattcagtcaaattctcattccattacaatctgtaatgataccaactcttccttcaatt
cctggtacacatgctaaccatgacccttttcctggatgctgggcctacattgcaggcttt
gatgatacggtagaaattcttgcttcccttcaaaagccaaagaagatcactttaaaaggt
tcggatgggaaatcttatattatgatgtgtaaacctaaagatgatctaagaaaggactgt
cggctcatggaattcaactctcttattaacaagtgcttaagaaaagatgcagagtcacgt
cggcgagaactccatatacgaacctatgcagttattccattaaatgatgaatgtggcata
attgaatgggtgaacaatactgctggtttaagaaatatcctaataaaactttataaggag
aagggtatctatatgactggaaaggaactacgtcagcatatgcttccaaagtcagcacct
ttgtctgaaaagctgaaaatgttcaaagaagtccttctgcctcgtcatcctcctgttttt
catgaatggtttcttagaacatttcctgatcctacttcatggtataacagcaggtctgcc
tactgccgttctgttgcagtcatgtcaatggtaggttacatacttggtctaggagaccgt
catggtgaaaacatcctgtttgattctttgactggtgaatgtgtgcatgtagatttcaac
tgccttttcaataaggtgagaaatggcatcttgctgcacttgctttatattttacttgca
tgtaattttgtaaacatctacaattgttttctttttttcttctaa

DBGET integrated database retrieval system