KEGG   Meleagris gallopavo (turkey): 100542698
Entry
100542698         CDS       T01523                                 

Gene name
CUL4B
Definition
(RefSeq) cullin-4B
  KO
K10609  cullin 4
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03420  Nucleotide excision repair
mgp04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100542698 (CUL4B)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100542698 (CUL4B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mgp04121]
    100542698 (CUL4B)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100542698 (CUL4B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mgp04147]
    100542698 (CUL4B)
Ubiquitin system [BR:mgp04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Cullin
     100542698 (CUL4B)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      100542698 (CUL4B)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      100542698 (CUL4B)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100542698 (CUL4B)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 SecA_SW
Other DBs
NCBI-GeneID: 100542698
NCBI-ProteinID: XP_003208504
Ensembl: ENSMGAG00000007563
LinkDB
Position
9
AA seq 884 aa
MFPTGFSSPNPSAAAQEVRPATDGSSGSSSSCKKRKLNNSNSEREEFDSISSCSSSPSKN
NSSSSSLVITASSCSSSGVASSNHHLQKKLRFEDSLDFIGLDVKMAEESSSSSSPAASSQ
QQHQQQLKNKSLLISSVAVGHHANGLTKAASSTVSSFANSKPGSAKKLVIKNFKDKPKLP
ENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDHIK
AQIHQFREDSLDSVLFLKKIDKCWQDHCRQMIMIRSIFLFLDRTYVLQNSMLPSIWDMGL
ELFRTHIISDQKVQNKTIDGILLLIERERNGEAIDRSLLRSLLSMLSDLQIYQDSFEHRF
LEETNRLYAAEGQRLMQEREVPEYLHHVNKRLEEEADRIITYLDQSTQKPLIATVEKQLL
GEHLTAILQKGLNHLLDENRIQDLSLLYQLFSRVRGGVQVLLQHWIEYIKAFGSTIVINP
EKDKTMVQELLDFKDKVDHIIDVCFLKNEKFVNAMKEAFETFINKRPNKPAELIAKYVDS
KLRAGNKEATDEELEKMLDKIMIIFRFIYGKDVFEAFYKKDLAKRLLVGKSASVDAEKSM
LSKLKHECGAAFTSKLEGMFKDMELSKDIMIQFKQYMQNQNVPGNIELTVNILTMGYWPT
YVPMEVHLPPEMVKLQEIFKTFYLGKHSGRKLQWQSTLGHCVLKAEFKEGKKELQVSLFQ
TLVLLMFNEGEEFSLEEIKQATGIEDGELRRTLQSLACGKARVLTKSPKGKDVEDGDKFT
CNDDFRHKLFRIKINQIQMKETVEEQASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLL
VSEVYNQLKFPVKPADLKKRIESLIDRDYMERDKENPNQYNYIA
NT seq 2655 nt   +upstreamnt  +downstreamnt
atgtttcccacaggtttctcttcccccaacccctccgctgcagctcaggaggtcaggcct
gccactgatggtagtagcggcagcagctcctcctgcaagaagagaaagttaaataacagc
aactccgaaagagaggaattcgattccatttcctcctgctcctcatctccttccaaaaac
aactcctcctcttcttctttggtcatcaccgcctcttcgtgctcctcctcaggggttgcc
tcctccaaccatcacctccagaagaagctgcgctttgaggactccttggattttatcgga
ctcgatgtgaagatggctgaagagtcttcttcctcctcctctcccgctgcctcttctcaa
cagcagcaccaacagcagctcaaaaataaaagccttttaatttcttcagtggccgtaggg
caccacgccaatggcctgaccaaagctgcctcctctactgtgtccagtttcgccaacagt
aaacctggctccgctaagaaattagtgatcaagaactttaaagataaacccaaattgcct
gaaaactacacagatgaaacctggcaaaaactgaaagaagccgtagaagcaatccagaac
agtacttccattaagtacaacttagaggagctctatcaggctgttgaaaatctctgctcc
tacaagatttcagcaaacttgtacaaacaattgagacaaatctgtgaagaccacattaaa
gcacaaattcaccagttcagagaggattcattggatagtgttctttttctaaagaaaata
gacaaatgttggcaagatcactgcagacaaatgattatgatcagaagtatttttttgttc
ttggaccgaacttacgtacttcagaattcgatgctgccatctatttgggatatggggcta
gaattgttcaggactcatataatcagtgatcagaaggttcagaacaaaactattgatggc
attcttctgctgatcgagagagaaagaaatggtgaggctattgataggagcttactgcga
agccttctgagcatgctttctgacttgcagatttatcaagattcttttgagcacagattc
ttggaagaaactaaccgtctgtatgcagcagaaggacagaggcttatgcaggaacgtgag
gttccagaatatcttcaccatgtcaacaagcgcttggaagaagaagcagacaggataatc
acttacttggatcagagcacgcagaagccactaattgctactgtagaaaagcaacttcta
ggtgaacatttaacagccattctccagaaaggtttaaaccaccttctggatgaaaaccga
attcaagacctgtcccttctgtatcagttattcagtcgtgtgagaggtggagtgcaagtt
ctcttgcaacactggattgagtacataaaggcatttggtagcaccatagtaattaatcca
gaaaaagacaaaaccatggtccaagaactgcttgattttaaagataaggttgaccatatt
attgatgtttgctttctcaagaatgagaagtttgtaaacgccatgaaagaagcctttgaa
acattcatcaacaaaagaccaaataagccagctgagctcatagctaaatatgtagactca
aagcttcgggcaggcaacaaagaagctactgatgaagaacttgaaaaaatgctggataaa
attatgatcatatttagattcatatatggaaaagatgtgtttgaggccttctataaaaaa
gatctagcaaagagactattagttgggaagagtgcttcagtagatgctgaaaaatctatg
ctttccaaactcaaacatgaatgtggagctgctttcacgagcaaacttgaaggaatgttt
aaagatatggagctttcaaaagacataatgatacaatttaaacagtatatgcaaaatcag
aatgtacctggcaatattgaactaacagtgaatatcttgactatgggttattggccaacc
tacgtgcctatggaggtccacctgcccccagagatggtaaaactgcaggagattttcaaa
actttttacttaggaaaacacagtggtaggaaacttcagtggcagtcaactctaggacac
tgtgtgctaaaagcagaatttaaagagggcaaaaaagaacttcaggtctccttgttccag
acactagtgctgctcatgtttaacgaaggagaggagttcagtctagaggagataaagcaa
gccactgggatagaggatggagagctgagaaggacacttcagtctctggcttgtggcaaa
gctagagtactgaccaagagccccaaaggaaaagatgtggaagatggtgataaattcaca
tgcaatgatgatttcagacataagctgttcaggataaaaatcaaccaaattcagatgaaa
gaaacggtagaggagcaggcaagcactacagagagagtgttccaggaccggcaataccag
atcgacgcggccatcgtacgaattatgaagatgagaaaaacactgagtcataacttgctt
gtgtcagaggtctacaaccagcttaaattcccagtaaagcctgctgaccttaagaagaga
atagaatccttaattgacagagactacatggaaagagataaagaaaacccaaatcagtac
aactatattgcataa

KEGG   Meleagris gallopavo (turkey): 100549149
Entry
100549149         CDS       T01523                                 

Gene name
CUL4A
Definition
(RefSeq) cullin-4A
  KO
K10609  cullin 4
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03420  Nucleotide excision repair
mgp04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100549149 (CUL4A)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100549149 (CUL4A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mgp04121]
    100549149 (CUL4A)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100549149 (CUL4A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mgp04147]
    100549149 (CUL4A)
Ubiquitin system [BR:mgp04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Cullin
     100549149 (CUL4A)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      100549149 (CUL4A)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      100549149 (CUL4A)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100549149 (CUL4A)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 SecA_SW
Other DBs
NCBI-GeneID: 100549149
NCBI-ProteinID: XP_010726908
Ensembl: ENSMGAG00000014851
LinkDB
Position
1
AA seq 759 aa
GRVQALPSRVGSRPALWLCRRAPLGRAEEDGCGEPCPSGRPQPPPCSPAERPKLPDNYTQ
DTWRKLHEAVAAIQSSTSIKYNLEELYQAVENLCSYKVSATLYKQLRQVCEDHVKAQILQ
FREDSLDSLLFLKKINKCWQDHCRQMIMIRSIFLFLDRTYVLQNSMLPSIWDMGLELFRN
HVISDKQVQNKTIDGILLLIERERSGEAVDRSLLRSLLSMLSDLQVYKESFEQRFLEETN
CLYAAEGQRLMQEREVPEYLHHVSKRLEEEGDRVITYLDHSTQKPLIACVEKQLLGEHLT
AILQKGLDNLLDENRISDLTQTYQLFSRVKGGQQILLQHWSEYIKNFGTTIVVNPEKDKD
MVQELLDFKDKVDHIIEVCFQKNEKFINLMKESFETFINKRPNKPAELIAKYVDSKLRAG
NKEATDEELERILDKIMIIFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLK
HECGAAFTSKLEGMFKDMELSKDVMVQFKQYMQNQSDPGNIDLTVNILTMGYWPTYTPME
VHLNSEMIKLQEVFKTFYLGKHSGRKLQWQTTLGHAVLKAEFKEGKKEFQVSLFQTLVLL
MFNEGDEFSFEEIKMATGIEDSELRRTLQSLACGKARVLIKNPKGKDVEDGDKFIFNGDF
KHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELY
NQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA
NT seq 2280 nt   +upstreamnt  +downstreamnt
ggccgcgttcaggcgctgccttctcgcgtagggtcgcgacccgccctgtggctgtgccgg
cgagcgcccctgggccgagcggaggaagatggctgcggggagccgtgcccctcgggccgc
cctcagccgcctccgtgttcccccgcagaaaggcccaaactgcccgataactacacgcag
gacacctggcgcaaacttcacgaggcggtggcagccattcagagcagcacttctattaaa
tacaacctcgaggagctctaccaggctgtggaaaacctctgttcctacaaagtctctgct
acactgtacaaacagctgcgacaagtctgtgaagatcacgtgaaagcacagatccttcaa
ttcagggaagattctctggatagtcttttatttttaaagaagataaataaatgctggcaa
gatcattgcagacaaatgatcatgatcagaagcattttcttatttttggatcgtacatac
gtacttcagaattcaatgcttccttctatatgggacatggggctggaattatttagaaat
catgtcattagtgataagcaagttcaaaacaagactattgatggaatccttctgctgatt
gaacgagaaagaagtggtgaagcagtggacagaagtttgctgcgtagtttgttgagtatg
ctgtctgatcttcaggtttacaaagaatcatttgaacagaggtttctggaagaaacaaat
tgcttatatgctgcagagggccaaagattaatgcaagaaagagaggtcccagaatatctt
caccatgttagtaaacgtttggaagaagaaggagacagagtgataacatacttagaccac
agcacacagaaaccactgattgcttgtgtggagaaacaactactaggagaacacctaaca
gctattttgcaaaaaggacttgataacctgcttgatgaaaacagaatatcagatttgacc
cagacataccagctgttcagcagggtaaaaggggggcagcagattcttctacaacattgg
agtgaatacatcaagaactttgggacaacaatagtggttaatcctgaaaaggacaaggat
atggtgcaagagctactagattttaaggataaagtggaccatatcatagaagtgtgcttt
cagaaaaatgaaaaatttataaacttgatgaaggagtcctttgaaacatttatcaacaag
agaccaaataagcctgcagaattgatagcaaaatatgtggattccaagttaagagctggt
aataaagaagcaacagatgaagagctggaaagaatcctcgacaaaatcatgatcatattt
agattcattcatggtaaagatgtgtttgaggcattctataagaaagatttggccaaaaga
ctgctggttggaaaaagtgcatctgtagatgctgagaagtccatgttgtcaaagcttaaa
catgaatgtggggctgcttttaccagcaaactggagggcatgttcaaggacatggaactg
tcaaaagatgtcatggttcagtttaagcagtatatgcagaaccaaagtgacccaggaaat
atagacctgacagtaaatatattaacaatgggatattggccaacttatacacctatggaa
gttcacttgaattcagagatgattaagcttcaagaggtatttaaaaccttttacctagga
aaacatagtggtcgaaagcttcagtggcagaccacattagggcatgctgtcctgaaggcg
gaatttaaagaaggaaagaaagaatttcaagtgtcgctctttcagacattagtgctgctt
atgtttaatgaaggagatgaattcagttttgaagaaattaaaatggccactggtatagag
gacagtgaattaagaagaaccttgcagtctttagcttgtgggaaagcacgagtattgatt
aaaaatccaaagggcaaggatgtagaagatggagacaaattcatctttaatggtgatttc
aagcataaattgtttagaataaagatcaatcaaatccagatgaaagaaacagtcgaggaa
caggttagcacaactgaaagagtatttcaagacagacagtatcagattgatgctgccatt
gtacgaataatgaagatgagaaagactcttggtcacaatctccttgtttctgaattgtat
aaccaactgaaatttccagtaaagcctggagacttgaaaaagaggattgaatctctcatt
gacagagactatatggaaagagacaaagacaaccccaatcagtaccactacgttgcataa

DBGET integrated database retrieval system