KEGG   Meleagris gallopavo (turkey): 100542909
Entry
100542909         CDS       T01523                                 

Gene name
CCNB2
Definition
(RefSeq) G2/mitotic-specific cyclin-B2
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04068  FoxO signaling pathway
mgp04110  Cell cycle
mgp04114  Oocyte meiosis
mgp04115  p53 signaling pathway
mgp04218  Cellular senescence
mgp04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100542909 (CCNB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100542909 (CCNB2)
   04114 Oocyte meiosis
    100542909 (CCNB2)
   04115 p53 signaling pathway
    100542909 (CCNB2)
   04218 Cellular senescence
    100542909 (CCNB2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100542909 (CCNB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    100542909 (CCNB2)
   03036 Chromosome and associated proteins [BR:mgp03036]
    100542909 (CCNB2)
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    100542909 (CCNB2)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100542909 (CCNB2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100542909
NCBI-ProteinID: XP_003209452
Ensembl: ENSMGAG00000005262
LinkDB
Position
12
AA seq 390 aa
MRGMENAVTGHNGKAKAQVTGKRAVLEEIGNKVTRGSNVPKKTDCIKPSVRATKGPGKVT
NTVAPSKPPAAVNQAVKDTTTASKVLSPVPMDVSMQEEDLCQAFSDVLLHNVEDIDADDS
ENPQLCSDYVKDIYLYLRQLELQQSVRPHYLDGKTINGRMRAILVDWLVQVHSRFQLLQE
TLYMCVAIMDRFLQSHPVSRKRLQLVGVTALLLASKYEEMYSPDIADFVYITDNAYSSAE
VREMEITILKELNFDLGRPLPLHFLRRASKAGEADAEQHTLAKYLMELTLIDYDMVHCHP
SEIAAAALCLSQKLLGHDKWGTKQQYYTGYTEDSLVMTMQHMAKNVVKVNENLTKYTAVK
NKYASSKLLRISTIPQLNCNTIKDLAASLL
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgagggggatggagaatgctgtgaccggacataatggcaaagccaaagctcaggtgact
ggtaaaagggctgttttggaagaaataggtaacaaagttacaagaggatccaatgtacct
aagaaaacggactgtatcaaaccatcagtaagggctacgaaaggacctggcaaggtgaca
aatacagttgcaccatctaaacctccagctgctgtgaatcaagcagtcaaagacactact
actgcttcaaaggttctgtcccctgtccctatggatgtatctatgcaagaggaggatctg
tgtcaagccttctctgatgtgttgctccacaacgtagaagacatcgatgcggatgactcg
gagaacccccagctatgtagtgactatgtaaaagatatctacctgtatctgagacagctt
gagctgcagcaatctgtgcgcccacattaccttgatgggaagacgatcaatggacgtatg
cgtgcaattttagttgattggcttgtccaggtccactcaagattccagcttcttcaggaa
acactgtatatgtgtgttgcaattatggaccgcttcttacaaagtcatccagtatctcgt
aagaggcttcagttggtgggtgtaacagcgctgcttctagcctcaaaatatgaagagatg
tactctcctgatatagcagacttcgtttatattactgacaatgcctacagcagtgctgaa
gttagagaaatggagatcacgattctgaaagaattgaactttgatttgggacggcctctt
ccacttcacttcttaagaagagcatcaaaagctggggaggcggacgctgagcaacacacg
ctagcaaaatacctaatggaactgacactgatagactacgacatggtgcactgtcacccc
tcagagatcgcagctgctgcgctgtgcttgtcgcagaagcttctgggccatgataagtgg
ggtacaaagcagcagtactatactgggtatacagaagacagcctcgtaatgactatgcag
catatggctaagaacgtcgtcaaagtaaatgaaaacttaacaaaatatactgctgtaaag
aacaagtatgcaagtagcaaactcctgaggatcagcacaatccctcaactgaactgtaac
actatcaaggacttagctgcatcactcttataa

DBGET integrated database retrieval system