KEGG   Meleagris gallopavo (turkey): 100543187
Entry
100543187         CDS       T01523                                 

Gene name
POLD2
Definition
(RefSeq) DNA polymerase delta subunit 2
  KO
K02328  DNA polymerase delta subunit 2
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03030  DNA replication
mgp03410  Base excision repair
mgp03420  Nucleotide excision repair
mgp03430  Mismatch repair
mgp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100543187 (POLD2)
   03410 Base excision repair
    100543187 (POLD2)
   03420 Nucleotide excision repair
    100543187 (POLD2)
   03430 Mismatch repair
    100543187 (POLD2)
   03440 Homologous recombination
    100543187 (POLD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    100543187 (POLD2)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100543187 (POLD2)
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    100543187 (POLD2)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      100543187 (POLD2)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     100543187 (POLD2)
SSDB
Motif
Pfam: DNA_pol_E_B DNA_pol_D_N
Other DBs
NCBI-GeneID: 100543187
NCBI-ProteinID: XP_010725008
LinkDB
Position
Unknown
AA seq 459 aa
MFSEVTPQPGHTLLGPPSAEPPTFPRAGSDFADRSQPFRLGERSFGRQYAHLYATRLLCM
RPRLEQQARLRWGDGVLLRKLCQLQAGERCCVVGTLFKAMRLQPSILQEINEEHNLVPQP
PLAKYVDPSDELVLEDELQRIKLTGSIEASRLVTGAVLAVYGHEQEDGKFVVEEHCFAHL
PPQLPWQGPSTDRFVLLASGLGLGSGSGESLLGTQLLVDAVTGQLGAEGQQSCAALISRV
LLAGNLLSQSTQSRDSLHKTQAASVEAVKMLDEILLQLCSSVPVDVMPGEFDPTNYTLPQ
QPLHRCMLPLSSAYPTLQLVTNPYQADVDGVRFLGTSGQNISDIFKYSSMDDYLEILEWT
LLAGHISPTAPDTLGCYPFYNSDPFILTDCPHVYFCGNAPKFQSKLLTGEDGQRVLLVAV
PAFSATQTACLVNLRDLSCQPISFSVFGAEDDSDMEVGQ
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgttctcagaggtcaccccccagccggggcacaccctgctgggccccccctcggccgag
ccccccacctttccccgcgccggtagcgactttgccgaccgctcgcagcccttccgcctg
ggggagcgcagctttggccggcagtacgcacacctctacgccacgcggctgctgtgcatg
cggccccgcctggagcagcaggcacggctccgatggggtgatggcgtgctgctgcggaag
ctgtgccagctgcaggcaggcgagcggtgctgcgtggtggggacgctcttcaaggccatg
cggctgcagccctccatcctgcaagagatcaacgaggagcacaacctggtgccgcagccc
cccctggccaagtatgtggacccatcggatgagctggtgctggaggacgagctgcagcgc
atcaagctgacggggagcattgaggcgtcgaggctggtgacaggcgctgtgctcgccgtg
tatggccacgagcaggaggatgggaagtttgtggtagaggagcactgcttcgcccacctg
cccccgcagctgccgtggcaggggcccagcaccgataggtttgtgttgctggcctccggg
ctggggttgggcagcggcagcggcgagtccctgctgggcacacagctgctggtggatgcg
gtgacggggcagctgggtgctgagggccagcagagctgtgctgcgctcatctcccgcgtc
ctgctggctgggaaccttctgagccagagcacacagagccgtgacagcctgcacaagaca
caagctgccagcgtggaggcggtgaagatgctggatgagatcctgctgcagctctgtagc
tccgtgcctgtggacgtgatgcctggagagtttgaccccaccaactacacgctgccacag
cagccgctgcaccgctgcatgctgcccctctccagcgcctaccccacactgcagctcgtc
accaacccttaccaggctgacgtggatggcgtccgatttttggggacgtcggggcaaaac
atcagcgatatcttcaagtacagcagcatggatgactacctggagatcctggagtggacg
ctgctggcaggacacatcagccccacggcccccgacacactgggctgctaccccttctac
aactctgatcccttcatcctcaccgactgcccacacgtttacttctgcggcaacgcgccc
aagttccagtccaagctgctgacaggggaggatgggcagcgggtgctgctggtggcagtg
ccagcctttagtgccacgcagaccgcctgcctcgtcaacctgcgcgacctcagctgccag
cccatcagcttctccgtctttggtgccgaggatgacagtgacatggaggtggggcagtga

KEGG   Meleagris gallopavo (turkey): 100551403
Entry
100551403         CDS       T01523                                 

Definition
(RefSeq) DNA polymerase delta subunit 3-like
  KO
K03504  DNA polymerase delta subunit 3
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03030  DNA replication
mgp03410  Base excision repair
mgp03420  Nucleotide excision repair
mgp03430  Mismatch repair
mgp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100551403
   03410 Base excision repair
    100551403
   03420 Nucleotide excision repair
    100551403
   03430 Mismatch repair
    100551403
   03440 Homologous recombination
    100551403
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mgp01009]
    100551403
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    100551403
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100551403
Protein phosphatases and associated proteins [BR:mgp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100551403
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    100551403
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      100551403
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     100551403
SSDB
Motif
Pfam: CDC27 DUF678
Other DBs
NCBI-GeneID: 100551403
NCBI-ProteinID: XP_031408018
Ensembl: ENSMGAG00000015317
LinkDB
Position
1
AA seq 192 aa
MNNFFGKAAMNKLKVNSVPEQPKEEKEAVKTSVPATEPESSPNTTVEKPGRKTEPAKIQQ
KDKKSKMKRMDKSDNEEEREPENQKKKRKRIKQLESDSSDEEDVPASPILEEEKAPSPPP
LVPALKAELEPASAEASTGGKKRKRKRVLKSKMFVDEEEGCMGKSGCLPRFCGSNFYCSC
TEDFLWVSLSWA
NT seq 579 nt   +upstreamnt  +downstreamnt
atgaacaacttctttggaaaagctgccatgaataaactcaaagtcaactcagtgcctgaa
cagccaaaggaggaaaaagaagctgtcaagacttcagttcctgcaacagaaccagagtca
tcccctaataccacagtagagaaacctgggaggaaaacagagcctgctaaaattcaacaa
aaggacaaaaagagtaaaatgaagaggatggacaagtctgacaacgaggaggaaagagag
cccgaaaatcaaaagaagaagaggaagagaatcaaacaactggaatctgacagcagtgat
gaggaagatgtcccagcatctcccatactcgaggaagagaaagctccatctccaccacct
ctggtacctgctctgaaggctgagctggagccagcatctgctgaggcttcaactggggga
aagaagaggaaacggaagcgtgtgctgaaatccaaaatgtttgttgatgaagaggaaggc
tgcatgggtaagagtggctgtctcccacgcttctgcgggtccaacttttattgcagttgt
actgaagattttttatgggtcagcctctcatgggcttag

KEGG   Meleagris gallopavo (turkey): 104909450
Entry
104909450         CDS       T01523                                 

Definition
(RefSeq) DNA polymerase delta subunit 3
  KO
K03504  DNA polymerase delta subunit 3
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03030  DNA replication
mgp03410  Base excision repair
mgp03420  Nucleotide excision repair
mgp03430  Mismatch repair
mgp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    104909450
   03410 Base excision repair
    104909450
   03420 Nucleotide excision repair
    104909450
   03430 Mismatch repair
    104909450
   03440 Homologous recombination
    104909450
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mgp01009]
    104909450
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    104909450
   03400 DNA repair and recombination proteins [BR:mgp03400]
    104909450
Protein phosphatases and associated proteins [BR:mgp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104909450
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    104909450
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      104909450
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     104909450
SSDB
Motif
Pfam: CDC27 CREPT PIG-L
Other DBs
NCBI-GeneID: 104909450
NCBI-ProteinID: XP_010704623
LinkDB
Position
1
AA seq 131 aa
MEDELYLENIDEFVTDQNRIVTYKWLSYTLGVHVNQAKQMLYDYVERKRKENSGAQLHVT
YLVAGNLTQNGHTCHKVAVVREDKLEAVKSKLTTVTSVHVYSIQKALLKDSGPLYNTDYD
IIKTNLHNCSK
NT seq 396 nt   +upstreamnt  +downstreamnt
atggaggacgagctgtacctcgagaacatcgatgagttcgtcaccgaccagaaccgcatt
gtgacatacaaatggctgagctatactctaggagtccacgtcaatcaggctaagcagatg
ctgtatgattatgtggagaggaaacgaaaggagaactcaggagctcagcttcatgtcacc
tacctggtagcaggaaacctcacccagaatggacatacatgccacaaggttgcagtagtg
agagaggataagctggaagcagtgaagtctaaactgaccacggttaccagcgtgcatgtc
tacagcattcagaaagccctgctcaaagacagcgggccgctctacaacacagactacgat
atcatcaaaaccaacctgcacaactgcagcaagtga

DBGET integrated database retrieval system