KEGG   Meleagris gallopavo (turkey): 100543413
Entry
100543413         CDS       T01523                                 

Gene name
AIFM2
Definition
(RefSeq) apoptosis-inducing factor 2
  KO
K22745  apoptosis-inducing factor 2
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100543413 (AIFM2)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 NAD_binding_9 K_oxygenase DAO HI0933_like GIDA NAD_binding_8 Lycopene_cycl AlaDh_PNT_C Trp_halogenase Peptidase_S28 FAD_binding_2 Thi4 FAD_binding_3 DUF4147 Amino_oxidase
Other DBs
NCBI-GeneID: 100543413
NCBI-ProteinID: XP_003207945
Ensembl: ENSMGAG00000004636
UniProt: G1MZI8
LinkDB
Position
8
AA seq 373 aa
MGSKLSVDDSVRVVIVGGGFGGIAAASQLKSWAVPFVLVDMRDAFHHNVAALRASVESGF
ARKTFISYAVTFGDSFRQGKVVGIDPERQQVLLSDGEELHYSHLILATGSDGPFPGKFNK
VIDMESAIQTYEDMVKEIEKSERIVVVGGGAAGVEMAAEIKTEYPAKEVTLIHSKIALAD
VELLQSVRQEVKEILLRKGVRLLLSEKVSNVENLTTNQFQKDMVVRTEKGTEVVADMVVL
CTGIKINSSAYATAFGDKLASNGALNVNKHLQVEGYDNIYAIGDCANLKEPKMAYHAGLH
ANIVVSNIINSLTHKPLKTYQPGSLTFLLSMGKNDGVGQVNGYYVGRLLVTTAKSRGLFV
SKSWKTMGQTMPS
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgggctccaagctgtccgtggacgactccgtgcgcgtcgtcatcgtcggcggcggcttt
ggtggcatcgcggccgccagccagctcaagtcctgggccgtcccctttgtgctggtggac
atgagagatgctttccaccacaacgtcgctgccctccgggcttccgtggagagcggattt
gccaggaagactttcatctcctacgccgtcacctttggcgacagcttccgacaaggcaag
gtggtgggcatagatcccgagaggcagcaggtcctgctcagcgatggtgaggaacttcac
tactcccaccttattcttgcaactggcagcgatggaccattccctgggaagttcaacaag
gtcattgacatggaaagcgccatccagacctatgaagacatggttaaggagattgagaaa
tctgagcgcatcgtggtagtgggaggtggtgctgctggagtcgagatggctgcagagatc
aaaacagagtacccagccaaagaggtcacccttattcactcaaaaattgcactagctgat
gtagagctgctacaaagcgtccgtcaggaggtgaaagagattctcctcaggaaaggagtt
cgcctcctgttgagtgagaaggtcagcaacgtggaaaatctcacaacgaaccagttccag
aaggacatggtagtaaggacagaaaagggcacagaggttgttgctgatatggtggtcctg
tgcacggggataaagattaactcttcggcatatgccactgcatttggagacaaactggcg
agtaacggagctttgaatgttaacaagcacctccaggtggaaggctatgacaacatctat
gccattggggactgtgcaaacctgaaagaaccaaagatggcataccatgctgggctgcat
gccaacattgtagtgtcaaatatcatcaacagcttgacacacaagccgcttaaaacctat
caaccaggatcactaacgttcctgctttcaatgggtaagaacgatggtgtaggccaggtg
aacgggtactacgtgggacgcctcctagtgaccactgctaaaagtcggggcctgtttgtt
tcaaagagctggaagacaatgggacagacaatgccctcttaa

DBGET integrated database retrieval system