KEGG   Meleagris gallopavo (turkey): 100543474Help
Entry
100543474         CDS       T01523                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00480  Glutathione metabolism
mgp00980  Metabolism of xenobiotics by cytochrome P450
mgp00982  Drug metabolism - cytochrome P450
mgp00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100543474
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100543474
   00982 Drug metabolism - cytochrome P450
    100543474
   00983 Drug metabolism - other enzymes
    100543474
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mgp02000]
    100543474
Enzymes [BR:mgp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100543474
Transporters [BR:mgp02000]
 Other Transporters
  Pores ion channels [TC:1]
   100543474
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_3 GST_C Glutaredoxin GST_C_5 GST_N_4
Motif
Other DBs
NCBI-GeneID: 100543474
NCBI-ProteinID: XP_010712980
Ensembl: ENSMGAG00000010660
LinkDB All DBs
Position
8
AA seq 239 aa AA seqDB search
MTGDHSRSLGKGSAAPGPVPEGVIRLYSMRFCPFAQRTRLVLRAKGIKHEVININLKNKP
DWIFEKNPSGLVPILETSKGQLIYESPITCEYLDDAFPGRKLMPSDPYERAFQRMLLERF
SKITAVISKALKEGDDLAALKAELAEKFGKLDEILSQRNTVFYGGDSSSLIDYMIWPWFE
RLEAFQLKDVLTHTPKLQHWMEAMKKDPAVKDTITDPQTLRVFLQLYFKNSPEACDYGL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcgatcactctcgcagcctgggcaagggtagcgcggcgccggggccggtgccc
gagggggtgatccggctgtacagcatgcgcttctgccccttcgcccagaggacgcgcctc
gttctccgtgccaagggcatcaagcatgaagtaattaacatcaatctgaagaacaaaccg
gactggatctttgagaagaacccttctgggctggttcctattctggagaccagcaagggc
cagctaatctatgagtccccaatcacttgtgagtatttggatgacgcatttccagggagg
aagctgatgccttcagatccatacgagcgagcctttcagagaatgcttctggaacgcttc
tcaaagataacagctgtaatttccaaggcactcaaagaaggagacgatcttgcagcgctg
aaagcagaattagctgaaaagtttggcaaacttgatgagattctctctcagcgcaacact
gtgttttatggtggggactccagctccctgattgactacatgatctggccctggtttgaa
cgcctggaagcattccagctgaaggatgttttgactcatactccaaaactccaacactgg
atggaggccatgaagaaggacccagctgtcaaagatacgatcactgacccacaaacactc
agagtttttctccagctctatttcaagaacagtccagaggcgtgtgattatgggctttga

DBGET integrated database retrieval system