KEGG   Meleagris gallopavo (turkey): 100543550
Entry
100543550         CDS       T01523                                 

Gene name
RBX1
Definition
(RefSeq) E3 ubiquitin-protein ligase RBX1
  KO
K03868  E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03420  Nucleotide excision repair
mgp04110  Cell cycle
mgp04114  Oocyte meiosis
mgp04120  Ubiquitin mediated proteolysis
mgp04141  Protein processing in endoplasmic reticulum
mgp04310  Wnt signaling pathway
mgp04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100543550 (RBX1)
   04120 Ubiquitin mediated proteolysis
    100543550 (RBX1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100543550 (RBX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100543550 (RBX1)
   04350 TGF-beta signaling pathway
    100543550 (RBX1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100543550 (RBX1)
   04114 Oocyte meiosis
    100543550 (RBX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mgp04121]
    100543550 (RBX1)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100543550 (RBX1)
Enzymes [BR:mgp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     100543550 (RBX1)
Ubiquitin system [BR:mgp04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   100543550 (RBX1)
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     100543550 (RBX1)
   ECV complex
     100543550 (RBX1)
   Cul3 complex
     100543550 (RBX1)
   Cul4 complex
     100543550 (RBX1)
   Cul7 complex
     100543550 (RBX1)
   Cul9 complex
     100543550 (RBX1)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      100543550 (RBX1)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      100543550 (RBX1)
SSDB
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3
Other DBs
NCBI-GeneID: 100543550
NCBI-ProteinID: XP_003202340
Ensembl: ENSMGAG00000012285
UniProt: G1NI60
LinkDB
Position
1
AA seq 108 aa
MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ
ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
NT seq 327 nt   +upstreamnt  +downstreamnt
atggcggccgcgatggatgtggacacccccagcggcaccaacagcggcgccggcaagaag
cgcttcgaagtgaagaaatggaacgcagtagctctgtgggcatgggacattgtggttgat
aactgtgccatttgcagaaaccatattatggatctatgcatagaatgtcaagcaaaccaa
gcatcggctacatctgaggagtgcacggttgcgtggggcgtctgcaatcacgctttccac
ttccactgcatctctcgctggctcaaaactcgccaagtatgcccactggacaacagggaa
tgggagttccaaaagtatggacactag

DBGET integrated database retrieval system