Meleagris gallopavo (turkey): 100543550 Help Entry 100543550         CDS       T01523                                  Symbol RBX1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism mgp  Meleagris gallopavo (turkey) Pathway mgp03420   Nucleotide excision repair mgp04110   Cell cycle mgp04114   Oocyte meiosis mgp04120   Ubiquitin mediated proteolysis mgp04141   Protein processing in endoplasmic reticulum mgp04310   Wnt signaling pathway mgp04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:mgp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100543550 (RBX1)    04120 Ubiquitin mediated proteolysis     100543550 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     100543550 (RBX1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     100543550 (RBX1)    04350 TGF-beta signaling pathway     100543550 (RBX1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     100543550 (RBX1)    04114 Oocyte meiosis     100543550 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mgp04121]     100543550 (RBX1)    03400 DNA repair and recombination proteins [BR:mgp03400]     100543550 (RBX1) Enzymes [BR:mgp01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      100543550 (RBX1) Ubiquitin system [BR:mgp04121]  Ubiquitin ligases (E3)   UBL E3 ligases    100543550 (RBX1)   Multi subunit Ring-finger type E3    SCF complex     Ring finger protein      100543550 (RBX1)    Cul2 complex      100543550 (RBX1)    Cul3 complex      100543550 (RBX1)    Cul4 complex      100543550 (RBX1)    Cul7 complex      100543550 (RBX1)    Cul8 complex      100543550 (RBX1)    Cul9 complex      100543550 (RBX1) DNA repair and recombination proteins [BR:mgp03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       100543550 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       100543550 (RBX1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  100543550 NCBI-ProteinID:  XP_003202340 Ensembl:  ENSMGAG00000012285 LinkDB All DBs Position 1:complement(48154702..48164903) Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggccgcgatggatgtggacacccccagcggcaccaacagcggcgccggcaagaag cgcttcgaagtgaagaaatggaacgcagtagctctgtgggcatgggacattgtggttgat aactgtgccatttgcagaaaccatattatggatctatgcatagaatgtcaagcaaaccaa gcatcggctacatctgaggagtgcacggttgcgtggggcgtctgcaatcacgctttccac ttccactgcatctctcgctggctcaaaactcgccaagtatgcccactggacaacagggaa tgggagttccaaaagtatggacactag

DBGET integrated database retrieval system