KEGG   Meleagris gallopavo (turkey): 100543855
Entry
100543855         CDS       T01523                                 

Gene name
XPA
Definition
(RefSeq) DNA repair protein complementing XP-A cells
  KO
K10847  DNA-repair protein complementing XP-A cells
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    100543855 (XPA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100543855 (XPA)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     100543855 (XPA)
SSDB
Motif
Pfam: XPA_C XPA_N PaREP1 TipAS zf-FCS
Other DBs
NCBI-GeneID: 100543855
NCBI-ProteinID: XP_010724490
LinkDB
Position
Z
AA seq 161 aa
MDSYLVQHFDWATCDNCRDAEDKHKLITRTEAKEEYLLKDCDLDKREPVLRFIVKKNPHN
PRWGDMKLYLKLQVIKRALEVWGNEESLQEAKEQRRDSREKMKQKKFDKKVKELRRAVRS
SLWKKTASIHEHEYGPEENVDEETYKKTCTICGHELTYEKM
NT seq 486 nt   +upstreamnt  +downstreamnt
atggattcgtacctagtgcagcactttgattgggccacgtgtgataattgcagagatgct
gaagataaacataagctcatcacaaggacagaagcaaaagaagagtatctcctgaaagac
tgtgacttagataagagagaaccggtgcttagattcattgtgaagaaaaaccctcataat
ccccggtggggtgacatgaaactttacttaaaactgcaggtaatcaagcgtgctctggaa
gtgtgggggaatgaagaatctttgcaagaagcaaaggaacagcgccgtgacagcagagag
aagatgaaacagaagaagtttgataaaaaagtgaaagagcttcgccgtgcagtgaggagt
agtttgtggaagaagacagctagtatccatgaacatgaatacggaccagaagaaaacgtt
gatgaagaaacatacaagaagacgtgtactatatgtggccatgagttaacttacgaaaag
atgtaa

DBGET integrated database retrieval system