KEGG   Meleagris gallopavo (turkey): 100543963
Entry
100543963         CDS       T01523                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04010  MAPK signaling pathway
mgp04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100543963 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100543963 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mgp04052]
    100543963 (KITLG)
Cytokines and growth factors [BR:mgp04052]
 Growth factors
  Growth factors (RTK binding)
   100543963 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 100543963
NCBI-ProteinID: XP_010707201
Ensembl: ENSMGAG00000011203
LinkDB
Position
1
AA seq 287 aa
MKKAQTWIITCFCLQLLLLNPLVKAQSSCGNPVTDDVNDIAKLVGNLPNDYLITLKYVPK
MDSLPNHCWLHLMVPEFSRSLHNLLQKFSDISNMSDVLSNYSIINNLTRIINDLMACLAF
DKNKDFIKENGHLYEEDRFIPENFFRLFNRTIEVYKEFADSMDKNECIMPSTVETPENDS
RVAVTKTISFPPVAASSLRNDSIGSNTSSNSNKEALGFISSSSLQGISIALTSLLSLLIG
FILGAIYWKKTHPKSRPESNETTQCHGCQEENEISMLQQKEKEHLQV
NT seq 864 nt   +upstreamnt  +downstreamnt
atgaagaaggcacaaacttggattatcacttgcttttgtcttcaactactcctacttaat
cctcttgtcaaagcccagagttcctgcgggaatccagtgacagatgatgtaaatgatatt
gcaaaattggttggaaatctcccgaatgattatctgataacccttaaatatgtcccgaag
atggatagcctgcctaatcattgttggttgcatttgatggtgcctgaattttcaaggagt
ctacataatcttctccagaagttttcggatatttccaatatgtctgatgttttaagcaac
tattcaatcattaataacctcacaaggataattaatgatcttatggcatgtctagctttt
gataaaaataaggattttataaaagaaaatggtcacctttatgaggaagatcgcttcatt
cctgagaatttttttaggctctttaatagaaccattgaggtctacaaggaatttgcagat
tcaatggataagaacgagtgcattatgccttcaactgtagaaacaccagagaatgattcc
agagtcgctgtcacaaaaacaatttcgtttcctcctgttgctgccagctcccttaggaat
gacagcattggcagtaatactagcagtaacagtaacaaagaggcacttggcttcattagc
agctccagcctgcaagggatcagcatagcattgacatcattgctgtctcttctcattgga
tttattttgggagccatatactggaagaaaacacatcctaaatccagaccagaaagtaat
gaaactacacagtgtcatggctgtcaagaggaaaatgagataagtatgttgcagcaaaaa
gaaaaagaacatctacaagtctag

DBGET integrated database retrieval system