KEGG   Meleagris gallopavo (turkey): 100543981
Entry
100543981         CDS       T01523                                 

Gene name
ERCC3
Definition
(RefSeq) general transcription and DNA repair factor IIH helicase subunit XPB
  KO
K10843  DNA excision repair protein ERCC-3 [EC:3.6.4.12]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03022  Basal transcription factors
mgp03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    100543981 (ERCC3)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100543981 (ERCC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mgp03021]
    100543981 (ERCC3)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100543981 (ERCC3)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     100543981 (ERCC3)
Transcription machinery [BR:mgp03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100543981 (ERCC3)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     100543981 (ERCC3)
SSDB
Motif
Pfam: ERCC3_RAD25_C Helicase_C_3 ResIII Helicase_C AAA_34 DUF2605
Other DBs
NCBI-GeneID: 100543981
NCBI-ProteinID: XP_010712079
Ensembl: ENSMGAG00000011706
LinkDB
Position
7
AA seq 721 aa
MGWMHAPSHAAFLGFLAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHIHEYKLTAYS
LYAAVSVGLQTSDITEYLQKLSKTGVPEGIIQFIKLCTVSYGKVKLVLKRNRYFVESTHP
DVIQQLLQDHVIKDCRLRNAEGEETELITETFTSKSAISKSSESSFGPSTSQEADVQNKP
DVPADLYEFYEQMDKDEEEEEETQTVSFEVKQEMIEELQKRCIQLDYPLLAEYDFRNDSV
NPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCL
VLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIDCSIAISTYSMLGHTTKRSWE
AERVMEWLKSREWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDLNF
LIGPKLYEANWMELQNSGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFR
ACQFLIKFHERRNDKIIVFADNVFALKEYAIRLGKPYIYGPTAQGERMQILQNFKHNPKI
NTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSL
VSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEELSFSSKEEQQQLLQKVLQASDL
DAEEEVVAGEYGSKSVQMSRRTGTMSSMSGADDAVYMEYHSSRSKASSNKHIHPLFKRFR
K
NT seq 2166 nt   +upstreamnt  +downstreamnt
atgggctggatgcacgccccaagtcacgctgcctttctgggctttcttgctcctgatggc
catattttcctggaagccttttctcctgtttacaaatatgcacaggattttttggttgcc
attgctgagcccgtgtgcagaccgacccacatccacgagtacaaactgacagcttactcc
ctgtatgctgctgtcagtgtcggcctgcagaccagtgatatcacagagtacctgcagaaa
ctgagcaagaccggtgtgccagagggaatcattcagttcatcaagctgtgtaccgtcagc
tatgggaaggtgaagctggtgctgaaacgcaacaggtattttgtggaaagtacccatcct
gatgtcattcaacaactcctgcaagaccacgttattaaagactgtcgcctgagaaatgct
gaaggtgaagaaacagagctcattacagagacattcacaagtaaatcagcgatttccaag
tccagcgaaagcagctttggtccatcgacatcacaagaagcagatgttcaaaacaagcca
gatgtcccagctgacttatatgagttttatgagcagatggacaaagatgaggaggaggag
gaagaaacacagacagtgtcttttgaagtcaagcaggagatgattgaagaacttcagaag
cgttgtatccaattggactacccattgctggcagaatatgatttcagaaatgattctgtg
aatcctgatattaatatagatctgaaacctacagctgtcctcagaccctatcaagagaaa
agcctgaggaagatgtttggaaatgggcgagccagatctggtgttattgtcttgccatgt
ggtgctggcaagtctctagttggagtgacagctgcgtgtaccgtccgcaagaggtgtctg
gtccttggtaattctgcagtgtctgtagaacagtggaaagcgcagttcaagatgtggtcc
accatcgatgacagtcagatatgtcgcttcacctctgatgccaaagataagcccattgat
tgttctattgctatcagcacgtattccatgttgggacacacgactaaaagatcctgggaa
gcagaaagagtaatggagtggcttaaaagtcgagaatggggccttatgatactcgatgaa
gtacatactattcctgcaaaaatgttcagacgtgtgctcactattgtacaagctcattgt
aaactgggactgactgctaccctggtcagagaagatgataaaattgttgatctgaacttc
ctgattggaccaaagctttatgaggccaactggatggagctgcagaacagtggctacatt
gctaaagtccagtgtgctgaggtttggtgcccaatgtcacctgaattttatagagagtat
gtagcaatcaaaacaaagaaacggatactactgtacaccatgaacccaaataagtttaga
gcttgccagttcctgattaagtttcatgagcgacggaatgataaaatcattgtttttgct
gacaatgtgtttgcactgaaggagtacgcaatcagacttgggaaaccatacatatatggt
cctactgcacaaggagaaagaatgcaaattctacaaaacttcaagcacaatccaaaaatc
aacactattttcatttcaaaggtgggtgacacgtcctttgatctgcctgaagccaatgtt
ctgattcagatttcatcccacggtggatctcggaggcaggaggctcaaagactggggcga
gtactgagagccaaaaaaggcatggttgcagaggaatacaatgcctttttttattctctt
gtatcccaagacactcaagaaatggcatattcaaccaagcgacaacggtttctcgtagat
caaggctatagcttcaaggtaataacaaagcttgcaggcatggaagaagaagaactttca
ttttcgtccaaagaagaacagcagcaacttcttcagaaagtcctacaagcatctgaccta
gatgctgaggaggaggtagttgctggagaatatggttcaaagtcagttcagatgtcacgt
cgtacaggcacaatgagctctatgtcaggagcagatgatgcggtttatatggaatatcac
tcatctcggagtaaggcatcttcaaataagcacatccacccactatttaagcgcttccgg
aaatga

DBGET integrated database retrieval system