KEGG   Meleagris gallopavo (turkey): 100544024Help
Entry
100544024         CDS       T01523                                 

Gene name
GANC
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00052  Galactose metabolism
mgp00500  Starch and sucrose metabolism
mgp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100544024 (GANC)
   00500 Starch and sucrose metabolism
    100544024 (GANC)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100544024 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 NtCtMGAM_N
Motif
Other DBs
NCBI-GeneID: 100544024
NCBI-ProteinID: XP_010709745
Ensembl: ENSMGAG00000011445
LinkDB All DBs
Position
5
AA seq 917 aa AA seqDB search
MAVIWVFLYVLHHIQDEAVDKSNFKECNQIAFYRRQKLLRPGKSLYRALLDTVSLSDENV
KFQISHEENKVLLQVEIYEIEGNIFRLKINEAAPLRARYEVPDVLIKEPTTQKLSMSQKE
GGVLVLANVNEDYKLRVTANPFQIELQFKDETVLSMNSNGLLYFEHLQPPPSDGNPTAEN
EEAAGDSSKDNQEDLGLWQEKFGSFLDIKAHGPSSVGMDFSLHGFDHLYGIPQHTESLLL
KNTSDGDAYRLYNLDIFGHKIHDKIGIYGSVPLLIAHKPDRTLGIFWLNSSETLVDINTK
AVAEHIPTESAADISKQRAVPLTDVRWMSESGIIDVFLLMGPTAFDIFKQFAQLTGTQAL
PPLFSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDVIWLDIEHTDGKRYFTWDKKKFQN
PKRMQELLRKKKRKLVVIVDPHIKADPMYTLYSQGKEKGYFVKDRNGKDFEGICWPGSSY
YLDFTNPEVRKWYADQFAFKTYKGSTNILFVWNDMNEPSVFKGAELTMQKDAVHYNNWEH
RELHNLYGFYQQMATAEGLIKRSSGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSYLKI
SIPMLLTISMAGISFCGADVGGFIGDPEPELLVRWYQAGAYQPFFRGHSNMKSKRREPWL
FGEKNTQIIREAIRERYVLLPYLYTLFYRAHTEAEPVMRPLWIEFPEKLETFGVEDEYML
GNALLVYPVTDKEAKAVSVLLPGLKEVWYDFRKFKRMEDQGTLKIPVTLENIPIFQRGGT
VIPLKTAAGKSTEWMTNISYELRVALNTEACAVGELYLDDGHSFQYLHKKQFLYRKFTFH
KNILSSSCTDESGQYRTTCVVERVIFLGLGQQPTLVTACSKGGKEKEVVFTHDTKTAVLI
LENLALRVDSDWEICIK
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcatctgggtttttttgtacgtattacaccacattcaagatgaagctgtggac
aaaagcaactttaaggagtgcaaccagattgctttctacagacgtcagaaacttctacgt
cctggaaaatccttgtatcgagcgctgttggatacagtctcattaagtgatgagaatgtc
aaattccaaattagtcatgaggagaataaggttcttctacaagtggaaatctatgaaata
gaaggcaatatttttaggcttaaaattaatgaggcagctcctctcagagcaagatatgaa
gttcctgatgttcttataaaggaacctaccacccagaaactctctatgtcccagaaggag
ggaggtgttttggtgttggcaaatgttaatgaggattacaagcttcgagtcacagcaaac
cccttccagattgagctacagttcaaggatgagactgttctgagcatgaattccaatggg
ttgttatattttgagcacctacaaccacctcccagtgatggaaaccctacagcagaaaat
gaggaggcagcaggtgattcctcaaaggataatcaggaggatctaggtctctggcaagag
aaatttggcagtttcttagacatcaaagctcatggtcctagttctgtaggcatggacttc
tctttacacggatttgaccatctttacggaataccacaacatacagaatcccttcttctc
aaaaacacaagtgatggtgatgcataccggctttataatttggacatctttggccacaag
atacatgacaagataggcatttatggttcagtgccacttctcatagcacacaagcctgac
agaactttggggatcttctggctgaattcttcagaaacactggtggatattaatacaaaa
gcagtagctgagcacatacctaccgaatctgctgcagatatttctaagcagagggcagtg
cctctaactgacgtgcgctggatgtcagaaagtggaatcattgatgtttttctgctgatg
ggacccacagcatttgatatcttcaagcagtttgcacaactgacaggaactcaagcacta
cctcccctcttttctctgggctaccaccagtgccggtggaattatgaagacgaacaagat
gtcaaggcagttgatgcgggttttgatgaacatgacattccttatgatgtaatatggctg
gacatagaacatacagatggcaagagatatttcacctgggataagaaaaaattccagaac
cccaagagaatgcaagaacttctcaggaagaaaaaacgcaagcttgtcgtcattgtagat
ccacatattaaagctgatcccatgtataccctgtattcacagggaaaagaaaagggatat
tttgtgaaagacagaaatggaaaagattttgagggcatctgttggccaggttcctcttac
tatctggatttcaccaatcctgaagtgcgaaaatggtatgcagatcaatttgccttcaaa
acatacaaggggtccactaatatcctctttgtgtggaacgacatgaacgagccgtcagtt
ttcaaaggggcagagctaacaatgcagaaagatgctgtgcactacaacaactgggagcat
cgggaattacacaacctctacggattctaccagcaaatggcaactgctgaaggactcatc
aaacgttcttctggaaaagagagaccatttgttctcacacgatctttctttgctggatca
caaaagtatggtgcagtgtggaccggagacaacacagcagagtggagttacttgaaaatc
tccattccaatgcttctcaccatcagcatggcagggatttcattctgtggagctgatgtg
ggagggttcattggagatccagaaccagaattacttgttcgctggtatcaggctggagcc
taccagcccttcttcagaggtcattctaacatgaagagcaaacggcgagaaccgtggctc
tttggggagaagaacacccagatcatcagggaagccattagagagcgctacgtcctcctg
ccatacttatacacactgttctatcgggcacacacagaggctgaaccagttatgaggcct
ctctggatagagttcccagagaaattagaaacttttggagtggaagatgagtacatgcta
ggaaatgctttgttggtatatccggtcacggacaaagaggccaaggcagtgagtgttcta
cttccagggttgaaggaggtttggtatgatttcagaaaatttaaacgaatggaagatcaa
ggcactctgaagatcccagtaacactggagaatattcccatattccagcgagggggcact
gtgatacctcttaagactgcagctggaaagtccactgaatggatgacaaatatttcttat
gaactccgcgtggcactgaacacagaggcctgtgcagtaggtgagctctacctagatgat
ggacattcatttcagtatctccataaaaagcagttcctgtaccggaaattcacttttcac
aagaacattctctcttccagctgcacagatgagagcggtcaataccgtaccacgtgtgta
gtcgagcgcgtgatatttctgggacttggacaacaacccactttagtgacagcctgttcc
aagggtgggaaagaaaaagaagtggttttcacacacgatacgaagactgctgtactgatt
ctggaaaatttagccctgagagttgatagtgactgggagatttgtatcaagtga

DBGET integrated database retrieval system