KEGG   Meleagris gallopavo (turkey): 100544037
Entry
100544037         CDS       T01523                                 

Gene name
SMAD3
Definition
(RefSeq) mothers against decapentaplegic homolog 3
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04068  FoxO signaling pathway
mgp04110  Cell cycle
mgp04144  Endocytosis
mgp04218  Cellular senescence
mgp04310  Wnt signaling pathway
mgp04350  TGF-beta signaling pathway
mgp04371  Apelin signaling pathway
mgp04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100544037 (SMAD3)
   04350 TGF-beta signaling pathway
    100544037 (SMAD3)
   04371 Apelin signaling pathway
    100544037 (SMAD3)
   04068 FoxO signaling pathway
    100544037 (SMAD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100544037 (SMAD3)
  09143 Cell growth and death
   04110 Cell cycle
    100544037 (SMAD3)
   04218 Cellular senescence
    100544037 (SMAD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100544037 (SMAD3)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 100544037
NCBI-ProteinID: XP_010715902
Ensembl: ENSMGAG00000009879
LinkDB
Position
12
AA seq 426 aa
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNI
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMEMCEYAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNYIPET
PPPGYLSEDGETSDHQMNPSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYE
LNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYI
GGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQG
FEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSI
RCSSVS
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgtcctccatcctgcccttcacccctcccatcgtcaagcggctcctgggttggaagaaa
ggggagcagaacgggcaggaggagaaatggtgcgagaaggcggtgaagagcctggtgaag
aagctgaagaagacggggcagctggacgagctggagaaggcgatcaccacgcagaacatc
aacaccaagtgcatcaccatccccaggtcgctggatggccggctgcaggtgtcccaccgc
aaggggctgccccatgtcatctactgccggctgtggcggtggccggacctgcatagccac
catgagctgcgagccatggagatgtgcgagtacgccttcaacatgaagaaggacgaagtc
tgcgtgaatccctatcattaccaacgagtggagaccccagtgttacccccagtgctggtg
cctcggcacacagagatcccagctgagttcccaccgctggacgattacagtcactctatc
ccagagaacactaacttcccagcaggcattgagccgcagagcaactacatcccagagaca
cctcctccaggctatttgagtgaggatggagaaactagtgaccaccagatgaaccccagc
atggatgcaggttctccaaacttatcaccaaatcctatgtctccggcacacaataatctg
gatctgcagcccgttacctactgcgagccggcgttctggtgctccatatcctactatgaa
ctcaaccagcgcgtgggggagacgttccacgcctcgcagccctccatgaccgtggatggt
ttcactgacccgtcgaattctgaacgcttctgccttggtctgctctctaatgtgaacaga
aatgcagcagtggagctcacaagacggcacatcggaagaggagtgaggctgtactacatt
ggcggcgaggtgtttgctgagtgccttagtgacagtgccatttttgtccagtctcccaac
tgcaaccagcgctacggctggcacccagcaacagtctgcaagatccccccaggatgtaac
ttgaagatttttaacaaccaggaatttgcagctctcttggctcagtctgtaaaccagggc
tttgaagctgtgtaccagctgaccaggatgtgcacgattcggatgagcttcgtcaagggc
tggggagcagaatacaggcggcagacggtgaccagcactccctgctggatcgagctgcac
ctcaacggccctctgcagtggctggacaaggtcctcacacagatgggctccccgagcatc
cgctgttccagcgtctcctaa

DBGET integrated database retrieval system