KEGG   Meleagris gallopavo (turkey): 100544220Help
Entry
100544220         CDS       T01523                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase 1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100544220 (SOD1)
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100544220 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 100544220
NCBI-ProteinID: XP_010721169
LinkDB All DBs
Position
1
AA seq 143 aa AA seqDB search
CCNHIGSNQHFVLQGSGPVKVTGKITGLSDGDHGFHVHEFGDNTNGCTSAGAHFNPEGKQ
HGGPKDADRHVGDLGNVTAKGGVAEVEIEDPVISLTGPHCIIGRTMVVHAKSDDLGRGGD
NESKLTGNAGPRLACGVIGIAKC
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
tgctgcaatcacatcggtagtaaccagcactttgtgttacagggtagtggaccggtaaag
gttactggaaaaattactggcttgtctgatggagatcatggcttccatgtccatgaattt
ggtgacaacacaaatgggtgtaccagtgcaggtgctcacttcaatcctgaaggcaagcag
cacggtggaccaaaagatgcagataggcacgtgggtgacctcggcaatgtgactgctaag
ggaggagtggcagaagtagaaatagaagatcctgtcatttctcttactggaccacactgc
atcattggccgtaccatggtggtccatgcaaaaagtgatgacctgggtagagggggagat
aatgagagcaaactaactggaaatgctggacctcgtttagcttgtggtgtaattgggata
gccaagtgctaa

DBGET integrated database retrieval system