KEGG   Meleagris gallopavo (turkey): 100544313
Entry
100544313         CDS       T01523                                 

Gene name
EI24
Definition
(RefSeq) etoposide-induced protein 2.4 homolog
  KO
K10134  etoposide-induced 2.4 mRNA
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100544313 (EI24)
SSDB
Motif
Pfam: EI24
Other DBs
NCBI-GeneID: 100544313
NCBI-ProteinID: XP_010721864
Ensembl: ENSMGAG00000000719
LinkDB
Position
26
AA seq 339 aa
MADSVKTFLHDLVRGIKDSIWGICTISKLDARIQQKREEQKRRRANSALAQRRFHMEERR
QENEPRIVSRIFQCCAWNGGVFWLSLFLFYQVFIPVLQSVTAQIIGDPSLHGDVWSWLEF
ILTSIFSALWVLPLFVLSKVVNAIWFQDIADLAFEVSGRKPHPFPSVSKIIADMLFNLLL
QALFLIQGMIVSLFPIDVVGQLISLLHMSLLYSLYCFEYRWFNKGIEMHQRLSNIERNWP
YYFGFGLPLAFLTAMQSSYIISGCLFSILFPLFIISANEAKTPGKTYHFQLRLFSLVVFL
SNRLFHKTVYLQSTLGSAPADRLLSPQPSPAKHKPAPGH
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggcggacagcgtgaaaaccttcctccatgacctcgtcaggggaatcaaggattccatc
tggggcatctgcaccatctccaagctggatgcccggatccagcagaaaagggaagagcag
aagcggaggagagcaaacagcgcgctcgcccagcggaggtttcacatggaagagaggagg
caagagaatgagccccggattgtgagccggatatttcagtgctgtgcctggaatggaggt
gtattctggcttagtctcttcttgttttaccaagtatttatacctgtacttcagtcagtc
acagcccagatcatcggtgacccttccttacatggcgatgtctggtcttggctggagttc
attctcacctccattttcagtgccctctgggtccttcccctgtttgtgctcagtaaggtc
gtcaatgccatctggtttcaggacatcgcagatctcgcattcgaagtttctggcagaaag
cctcacccctttcccagtgtcagtaaaatcattgccgacatgttgttcaacctcctgctg
caggcactgttcctcatccaggggatgattgtgagtctgttccccatcgatgtcgtcggc
cagctgatcagcctcctgcacatgtccctgctctattctctctactgtttcgagtaccgc
tggtttaacaaaggaattgaaatgcaccaacggttgtccaacattgagagaaactggccc
tattactttggatttggcttaccactggctttcctcaccgcaatgcagtcctcctatatc
atcagtggctgcctcttttccatccttttccctctgttcatcatcagcgccaacgaagca
aagacacctggcaaaacgtaccacttccagctccgtctcttctccctggtggttttcctc
agcaacagactcttccacaagaccgtttaccttcagtccaccctgggcagcgcccctgca
gacaggctgctctctccccagccgtctcctgccaaacacaagcctgctccggggcactga

KEGG   Meleagris gallopavo (turkey): 100545625
Entry
100545625         CDS       T01523                                 

Gene name
TP53I3
Definition
(RefSeq) quinone oxidoreductase PIG3 isoform X1
  KO
K10133  tumor protein p53-inducible protein 3 [EC:1.-.-.-]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100545625 (TP53I3)
Enzymes [BR:mgp01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     100545625 (TP53I3)
SSDB
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N ADH_N_2
Other DBs
NCBI-GeneID: 100545625
NCBI-ProteinID: XP_003204596
Ensembl: ENSMGAG00000014058
LinkDB
Position
2
AA seq 370 aa
MLTHRFSGSSFTFKLLHSLCCPSALQPMFLPSRGKMLAAHFDSPGGPENLYVKEVMKPRP
GEGEVLVKVSASALNRADLLQRRGKYPPPKGASDILGLEAAGSVAGLGPGCTGRWKIGDA
VMALLSGGGQAEYVTVPEGHLMPVPKDITFIQAAAIPEAWLTAFQLLHFVGKIQKGETVL
IHAGASGVGMAAIQLVRLANAIPIVTAGTQEKLKATTNAGAAAGFNYKNEDFCEKVLAFT
QGSGVDIILDCVGGSYWEKNLSCLRTDGRWVIYGLLSGGEVHGDLLARLLSKRGSIHTSL
LRSRDKEYKEQLVKAFIENVLPYFSEGASPHLQPLVDSIYPLHEIVEAHRKMEESKNIGK
IVIEMPLKSP
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgctaactcaccgtttctcaggcagctctttcaccttcaaactgcttcacagtctgtgt
tgtccatctgcacttcagcccatgtttctgccttccagagggaagatgctggcagcccac
tttgattccccaggaggcccagaaaatctctatgtaaaagaagtgatgaaaccacgtcca
ggagaaggagaagttcttgtgaaggtctctgccagtgctctgaatagagctgatttactc
cagaggagagggaagtaccctccccccaaaggagcaagtgatattttaggcttagaagca
gctgggagtgtggctgggctcggacctggctgcactgggcggtggaagattggcgatgca
gtgatggctctgctctctggaggcggccaggctgaatatgttacagtacctgaaggccac
ctgatgccagttcccaaagatattacatttattcaggctgcagccattcctgaggcttgg
ttaacagcttttcagctgctgcattttgtaggtaaaatacagaaaggggaaacagtgtta
atccacgctggagctagcggggttggtatggcagccattcagctggtcagactggcaaat
gctattcccatcgtgacagcaggaactcaggagaaactcaaagcaacaacaaacgctgga
gcagctgcagggttcaactacaagaatgaagatttttgcgaaaaggtcttggccttcacc
caaggttctggagtagatattattttagattgtgttggtggctcttactgggagaagaat
ctcagctgcttgagaactgatggccggtgggttatttatggactactgagtggaggtgaa
gttcatggagatttgcttgcaaggctgctttccaaaagagggagcatccacacaagtcta
ttaagatcacgagacaaggagtataaggagcagctggtgaaagccttcatagaaaatgtg
ctgccctatttctctgaaggagcctctccgcatctccagccgcttgtcgacagcatttac
cctctgcatgagattgtggaggcacacaggaaaatggaagaaagcaagaacattggcaaa
attgtcatcgaaatgccactgaaatcaccctaa

DBGET integrated database retrieval system