KEGG   Meleagris gallopavo (turkey): 100544339
Entry
100544339         CDS       T01523                                 

Gene name
MNAT1
Definition
(RefSeq) CDK-activating kinase assembly factor MAT1 isoform X1
  KO
K10842  CDK-activating kinase assembly factor MAT1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03022  Basal transcription factors
mgp03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    100544339 (MNAT1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100544339 (MNAT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mgp03021]
    100544339 (MNAT1)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100544339 (MNAT1)
Transcription machinery [BR:mgp03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100544339 (MNAT1)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     100544339 (MNAT1)
SSDB
Motif
Pfam: MAT1 zf-C3HC4_5 zf-RING_UBOX zf-RING_5 zf-C3HC4 zf-UDP
Other DBs
NCBI-GeneID: 100544339
NCBI-ProteinID: XP_003206833
LinkDB
Position
5
AA seq 309 aa
MDEQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVELLFVRGAGNCHECDTPLRKSNFRV
QLFDDPAVDKEVEIRKKVLKIYNKREDDFPSLSEYNDFLEEIEEIVFNLTNNVDLENTKR
KMELYQKDNKEVIQKNKIKLTREQEELEEALEVERQENEQRRLLEQKEEQLQQMMKRKNK
QALLDELESSSLPASLLLAQHKDRSTQLEMQLEKPKPVKPVTFSTGIKMGQQISLAPIQK
LEETLYEYQPLQVETYGPAVPDLESLGRLGYLNHVRAASPQDLAGGYTSSLACHRALQDA
FSGLFWFPS
NT seq 930 nt   +upstreamnt  +downstreamnt
atggacgagcagggctgcccgcgctgtaagaccaccaagtaccgcaacccctccttgaag
ctgatggtcaacgtctgcgggcacacgctatgtgagagctgcgtggagctgctgttcgtg
agaggggctgggaactgccatgagtgcgatacaccgctgcggaagagtaacttcagggta
cagctcttcgacgatcctgctgttgacaaggaagtggaaattcgtaagaaagtgctgaaa
atatacaataaaagagaggatgactttcccagcctaagtgaatataatgatttcctggaa
gaaatagaagaaattgtgtttaacttgactaacaatgtggatttggagaacaccaaaagg
aaaatggagctgtaccagaaggataacaaagaagtcattcagaaaaacaagataaaactg
acccgggagcaggaagagttggaggaagctttagaggtagaacgacaggaaaatgaacaa
aggcgactgcttgaacagaaagaggaacagctacaacagatgatgaaaaggaagaataaa
caagcactcttggatgaactggagagctccagtcttcctgcttcgctgcttttggctcag
cataaagacagatctactcagctagaaatgcaactggaaaaacccaaacctgtcaaacca
gtcacattttccaccggcatcaaaatgggtcagcagatttcgttagctcctattcaaaag
ctggaggaaactttgtatgagtatcagcctctgcaagtggagacatatggaccagcagtt
ccagatcttgaaagtttgggaagactggggtacctgaaccacgtacgagccgcttctcca
caggatcttgctgggggctacacttcttctcttgcgtgccaccgagccttgcaggatgct
ttcagtggtctcttctggttccccagttag

DBGET integrated database retrieval system