KEGG   Meleagris gallopavo (turkey): 100544420
Entry
100544420         CDS       T01523                                 

Gene name
MDM4
Definition
(RefSeq) protein Mdm4 isoform X1
  KO
K10127  protein Mdm4
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100544420 (MDM4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mgp04121]
    100544420 (MDM4)
Ubiquitin system [BR:mgp04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    100544420 (MDM4)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP
Other DBs
NCBI-GeneID: 100544420
NCBI-ProteinID: XP_003212938
Ensembl: ENSMGAG00000002885
LinkDB
Position
28
AA seq 522 aa
MHLAAAGRELSQALAECSQLLPGAEAQGGLGAGKFKAGLYHKQLITATMTSSSSAQHPTA
ENACRITLGQANQVRPKLPLLKILQAAGAQGETFTLKEVMHYLGQYIMVRQLYDKRQQHM
VYCGGDQLGELLGLESFSVKDPSPVYDMLKRNLTSAAMTDAAQNLAKEQSVDKPSQDQLK
FSPKEGSDTVIVEDESNASAVSTSEHKCENYEDKDLIENLSKSKKPKLDLVFEEWDVAGL
PWWFLGNLRSNYKSRSNGSTDIQTNQDVDTAIVSDTTDDLWFLNESPLDQTNTAVKMETA
DCEEVKEGDKKVTEDACLHDFEDSQCLSDDTDTEAASEDCWQCTKCKKFNSPGKRYCYRC
WALRKDWYSDCPKLTHSLSLSNIDAMQNENSDEGIDVPDCRRTISAPVGPPKDMYVVENK
SHADPCGSIESLDLARECESRDSLLRFTEHKKEEEIQSLESIKKLLNPCFLCHHRPRDGN
IVHGRTAHLVACFKCAKMLKKKRSPCPVCRKDIEMVIRIFMG
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgcatttagctgcagctggcagggagctcagccaggctcttgcagagtgctcacagctc
ttaccaggagcagaggcacagggaggacttggagcagggaagttcaaggctggtttgtac
cataaacagcttatcactgccacaatgacatcttcaagctctgcccagcatccaacagct
gagaacgcctgcagaatcactcttggacaagctaaccaggtgcgacccaaactccctctt
ctgaagattctgcaggctgcaggtgcccaaggtgaaaccttcaccctaaaggaggttatg
cattacctaggacagtatataatggtgaggcagctgtatgacaaaaggcagcaacacatg
gtgtattgtggaggagatcagctgggagaattgctggggctggaaagcttctctgtaaaa
gatccaagcccagtttatgacatgttgaaacggaaccttacttctgctgccatgacagat
gctgcacagaatctcgcaaaggaacagagcgtcgataagccaagccaagaccagctgaag
tttagcccaaaggaaggttctgacactgtcatcgtggaggatgaaagcaatgcatctgct
gtgtctacctcagagcacaaatgtgagaattatgaagacaaagacttaatagaaaacctc
tctaaaagcaagaagcctaaactggacctagtgtttgaggaatgggatgtagctggtctt
ccatggtggtttttaggcaacctcagaagcaattacaagtccagaagtaatggatcaaca
gatattcagactaaccaggatgtagacactgccattgtttcagatactactgatgatttg
tggttcctcaacgaaagtcccttggatcagaccaacactgcagtcaaaatggaaacagct
gactgcgaggaagtgaaggaaggtgacaaaaaggtgactgaggatgcatgtttgcatgac
tttgaggattctcagtgtttaagcgacgacacagatacagaagctgcttctgaggactgc
tggcaatgcaccaaatgcaagaagtttaactctccaggcaaacggtactgttaccgctgc
tgggccttacgcaaggactggtactcagattgtcccaaactcactcattctctttctctg
tccaacattgatgctatgcaaaatgaaaacagtgatgaagggatcgatgtcccggactgc
cgaaggactatttctgctccagttggcccacctaaagacatgtatgtggtagaaaacaaa
tcacacgcagatccctgcggctctattgagtccttggatttggcacgagaatgtgaaagc
agggactctctgttgcgtttcactgagcataaaaaggaggaagaaatacagtctttagag
agtataaaaaagttactgaatccttgcttcctgtgccatcacagaccgcgagatgggaat
attgtccatgggaggactgctcaccttgtggcctgtttcaagtgtgcaaagatgctgaag
aaaaagagatcaccttgcccggtgtgcaggaaagacattgagatggtgattagaatcttt
atggggtag

DBGET integrated database retrieval system