Meleagris gallopavo (turkey): 100544693 Help Entry 100544693         CDS       T01523                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism mgp  Meleagris gallopavo (turkey) Brite KEGG Orthology (KO) [BR:mgp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mgp03036]     100544693   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mgp04147]     100544693 Chromosome and associated proteins [BR:mgp03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100544693 Exosome [BR:mgp04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100544693 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  100544693 NCBI-ProteinID:  XP_010710363 LinkDB All DBs Position 1:complement(46466728..46469300) Genome browser AA seq 78 aa AA seqDB search MGQRDCCLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRV TIMPKDIQLARRIRGERA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggggcagcgcgactgctgcctgcccttccagcgcctggtgcgcgagatcgcgcaggac ttcaagaccgacctgcgcttccagagctcggccgtcatggcgctgcaggaggcgagcgag gcctacctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtc accatcatgcccaaggacatccagctcgcccggcgcatccgcggggagcgcgcctga

DBGET integrated database retrieval system