KEGG   Meleagris gallopavo (turkey): 100544986
Entry
100544986         CDS       T01523                                 

Gene name
SFN
Definition
(RefSeq) 14-3-3 protein sigma
  KO
K06644  stratifin
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04110  Cell cycle
mgp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100544986 (SFN)
   04115 p53 signaling pathway
    100544986 (SFN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mgp04147]
    100544986 (SFN)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100544986 (SFN)
  Exosomal proteins of colorectal cancer cells
   100544986 (SFN)
  Exosomal proteins of bladder cancer cells
   100544986 (SFN)
SSDB
Motif
Pfam: 14-3-3 Peptidase_C98
Other DBs
NCBI-GeneID: 100544986
NCBI-ProteinID: XP_003212551
LinkDB
Position
25
AA seq 246 aa
MARNHQVQKAKLAEQAERYEDMADFMKAVVEHGDELSNEERNLLSVAYKNVVGCQRSAWR
VISSIEHKTEEGDDKAQLVNEYREKVEEELKGVCNVVLGLLEKHLIKKASDAESKVFYLK
MKGDYFRYLAEVAAGNDRKETIDSAQKAYQEAMDISKKEMQPTNPIRLGLALNFSVFHYE
IANAPEQAISLAKTTFDEAMGDLHTLSEDSYKDSTLIMQLLRDNLTLWTAECAGEDGGEA
GEEPKN
NT seq 741 nt   +upstreamnt  +downstreamnt
atggcaagaaaccaccaagtgcagaaagccaagctggccgagcaggccgagcgctacgag
gacatggcggacttcatgaaggcggtggtggagcacggtgacgagctgtccaacgaggag
cgcaacctcctctccgtcgcctacaagaacgtggtgggctgccagcgctcggcctggagg
gtcatctccagcatcgagcacaaaaccgaggagggcgacgacaaagcgcagctggtgaac
gaatacagggagaaggtggaagaggagctgaagggcgtctgcaacgtggtgctgggcttg
ctggagaagcacctcatcaagaaggccagcgacgccgagagcaaagtgttctacctgaag
atgaagggagactatttccgatacctggccgaggtggccgccggcaacgaccgcaaggag
acgatcgacagcgcccagaaggcgtaccaagaggccatggacatcagcaaaaaggagatg
cagcccacgaaccccatccgcctggggttggccctcaacttctccgtcttccactacgag
atcgccaacgcccccgagcaggccatctcgctggccaagaccaccttcgacgaggccatg
ggggacctgcacacgctcagcgaagactcctacaaggacagcaccctcatcatgcagctg
ctcagggacaacctgacgctatggacagccgagtgcgcgggcgaagacggcggcgaggct
ggtgaagagcccaagaactga

DBGET integrated database retrieval system