KEGG   Meleagris gallopavo (turkey): 100545008
Entry
100545008         CDS       T01523                                 

Gene name
BCL2
Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
mgp04140  Autophagy - animal
mgp04141  Protein processing in endoplasmic reticulum
mgp04210  Apoptosis
mgp04217  Necroptosis
mgp04261  Adrenergic signaling in cardiomyocytes
mgp04340  Hedgehog signaling pathway
mgp04510  Focal adhesion
mgp04621  NOD-like receptor signaling pathway
mgp05132  Salmonella infection
mgp05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100545008 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100545008 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100545008 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    100545008 (BCL2)
   04217 Necroptosis
    100545008 (BCL2)
   04115 p53 signaling pathway
    100545008 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100545008 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100545008 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100545008 (BCL2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100545008 (BCL2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100545008 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mgp01009]
    100545008 (BCL2)
Protein phosphatases and associated proteins [BR:mgp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100545008 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 100545008
NCBI-ProteinID: XP_010706727
LinkDB
Position
3
AA seq 233 aa
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRPPVPPALAPTAAPAAXXXXXXXXX
XXXEPPGSAAASEVPPAEGLRPAPPGVHLALRQAGDEFSRRYQRDFAQMSGQLHLTPFTA
HGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIATWMTEYLNRHLH
NWIQDNGGWDAFVELYGTSMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
NT seq 702 nt   +upstreamnt  +downstreamnt
atggctcaccccgggagaagaggctacgacaaccgcgagatagtgctgaagtacatccac
tataaactctcgcagcggggctacgactgggccgccggcgaggacaggccacccgtgccc
ccggccctggctcccactgctgctcccgctgcnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnngagccccccggctcggctgctgctagtgaggtgcccccagctgaggggctg
cgccccgcacctcccggcgtccacctcgccctgcgccaggccggggatgagttctcgcgc
cgctaccagagggactttgcccagatgtcgggccagctgcacctgacgcccttcacagcc
cacggccgcttcgtggccgtggtggaggagcttttccgtgatggggtcaattggggccgg
atcgtcgccttctttgagttcggcggcgtgatgtgcgtcgagagcgtcaaccgggagatg
tcgccgctggtggacaacattgccacctggatgaccgaatacctgaacaggcacctgcac
aactggatccaggacaacggaggatgggatgccttcgtggaattgtacggcaccagtatg
aggcctttgtttgatttctcctggatctctctgaagaccatcctgagcctggttctggtg
ggagcttgcatcactcttggcgcttatcttggacataagtag

DBGET integrated database retrieval system