KEGG   Meleagris gallopavo (turkey): 100545037
Entry
100545037         CDS       T01523                                 

Gene name
TP73
Definition
(RefSeq) tumor protein p73 isoform X1
  KO
K10148  tumor protein p73
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100545037 (TP73)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mgp03000]
    100545037 (TP73)
Transcription factors [BR:mgp03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    100545037 (TP73)
SSDB
Motif
Pfam: P53 P53_tetramer SAM_2 SAM_1
Other DBs
NCBI-GeneID: 100545037
NCBI-ProteinID: XP_003212229
Ensembl: ENSMGAG00000001562
LinkDB
Position
23
AA seq 660 aa
MLPIPRAMESSMEAGVIYPLSDSPSVKMSQSSPADESTTFEHLWSTLAPDSTYFDLSPSS
HTGDNEVSNRTEITMDVFQMRGMNDSVMSQFNLLNNSMDQSIGSRAASTSPYSSEHTSNV
PTHSPYSQPSSTFDAMSPAPVIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYC
QIAKTCPIQIKVSSPPPPGTIIRAMPVYKKAEHVTEVVKRCPNHELGRDFNDGQSAPASH
LIRVEGNNLSQYVDDPVTGRQSVMVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILI
IITLETRDGQVLGRRSFEGRICACPGRDRKADEDHYREQQALNESAAKNGNANKRTFKQS
PQAIPALGPGVKKRRHGEEEMYYVPVRGRENFEILMKIKESLELVELVPQQLVDSYRQQQ
QQLLQRQNQLQTPSSYGPVLSPMNKVHGGGINKLPSVNQLVGQPAQHSSGSASSLGPMGP
GMLNSHPMQPNGEMNGGHSSQSMVSGSHCTPPPPYNPDPSLVSFLTGLGCPNCIDYFTSQ
GLQNIYHLQNLSIEDLGALKIPEQYRMIIWRGLQELKQSHDYGAQQLIRSSSNASTISIG
SSGELQRQRVMEAVHFRVRHTITIPNRGAADEWADFGFDLPDCKSRKQSIKEEFTEGEIN
NT seq 1983 nt   +upstreamnt  +downstreamnt
atgctaccgatacccagggccatggaaagcagcatggaagcaggagtgatttacccttta
tcagactccccctctgtgaagatgtcccagtcctctcctgctgatgaaagcacaacattt
gaacacctctggagtacactggcaccagacagcacctacttcgacctctctccatccagt
catacaggtgacaatgaggtctccaaccgcacagagatcacaatggatgtcttccagatg
agaggcatgaatgactctgttatgtcccagtttaatttgctgaacaacagcatggatcag
agcatcggcagcagagcagcctccaccagcccttacagctccgagcacacctccaatgtc
ccaacgcattcaccctactcgcagcccagctctaccttcgacgccatgtccccagctcct
gtcatcccctccaacactgactacccaggtccccaccactttgaggtgaccttccagcaa
tccagcacagccaagtcagccacctggacatactccccactgctgaagaagctctattgt
cagattgccaagacatgtcccatccagatcaaggtgtccagcccacctccaccaggcacc
atcatccgggccatgcctgtctacaagaaggccgagcacgtgacagaagtggtgaaacgc
tgccccaaccatgagctggggcgtgactttaacgatggccagtcagccccagccagccac
ctcatcagggtggaaggcaacaacctctcccagtacgtggacgaccctgtgacaggacgg
cagagtgtgatggtgccctacgagcccccacaggtggggaccgagttcaccactatcctg
tacaacttcatgtgcaacagtagctgtgtgggaggaatgaacaggagacccatcctcatt
atcatcacgctggagacgagagacggccaagtcctaggaaggcgatcatttgagggacgg
atctgtgcctgtcctggcagagacaggaaagctgatgaagaccattaccgagagcaacaa
gccctgaatgagagtgcagctaaaaatggcaacgccaacaaacgcacattcaaacagagc
cctcaggcaatcccagcactggggccaggcgttaagaaacggagacacggggaggaggag
atgtattatgtgcctgtgcgaggcagggagaacttcgagatcctgatgaagataaaagag
agcctggagctggtggagctggtcccgcagcagctggttgactcctatcggcagcaacag
cagcagcttctgcagaggcaaaatcagctgcagacaccttcctcctacggccctgtcctc
tcacctatgaataaagtccacggaggaggaatcaacaagctgccctctgtcaaccagctg
gtcgggcagccagcacagcacagctctggctcagcatcaagcctggggccaatgggacct
gggatgctgaacagccaccccatgcaacccaatggagaaatgaacgggggccattcgtcc
cagtccatggtctcaggatcacactgcacccctcctccaccctacaaccccgatcccagc
ctggtcagttttttaacaggattggggtgtccaaactgcatcgactatttcacctcacaa
gggttacagaatatttaccacctgcagaacctatccatagaggatctcggagcactgaag
atcccagagcagtaccggatgatcatctggaggggccttcaagaactcaagcagagccac
gactacggggcccagcagctcatccgctccagcagcaacgcctccaccatctccattggc
agctcgggggagctgcagcggcagcgcgtgatggaggccgtgcacttccgcgtgcgccac
accatcaccatccccaaccgcggcgcggcggatgagtgggcagactttggctttgacctc
ccagactgcaagtcccgcaaacagtccataaaagaagaattcacggagggagagatcaac
tga

DBGET integrated database retrieval system