KEGG   Meleagris gallopavo (turkey): 100545256
Entry
100545256         CDS       T01523                                 

Gene name
GTF2H5
Definition
(RefSeq) general transcription factor IIH subunit 5
  KO
K10845  TFIIH basal transcription factor complex TTD-A subunit
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03022  Basal transcription factors
mgp03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    100545256 (GTF2H5)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100545256 (GTF2H5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mgp03021]
    100545256 (GTF2H5)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100545256 (GTF2H5)
Transcription machinery [BR:mgp03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100545256 (GTF2H5)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     100545256 (GTF2H5)
SSDB
Motif
Pfam: Tfb5
Other DBs
NCBI-GeneID: 100545256
NCBI-ProteinID: XP_003204187
Ensembl: ENSMGAG00000012863
UniProt: G1NJN0
LinkDB
Position
2
AA seq 71 aa
MVNVLKGVLIECDPAMKQFLLYLDESNALGKKFIIQDLDETHVFVLAELVNFLQERVGEL
MDQNSFPITQK
NT seq 216 nt   +upstreamnt  +downstreamnt
atggtgaatgttctgaagggcgttctgattgaatgtgacccagcaatgaagcagtttctg
ctctacttggatgagtcaaatgctttgggaaagaagttcatcatacaagacctggatgaa
actcatgtctttgtattagcagagttggttaacttcctccaggagagagtgggcgagtta
atggaccagaactcttttcctattactcagaaataa

DBGET integrated database retrieval system