KEGG   Meleagris gallopavo (turkey): 100545308
Entry
100545308         CDS       T01523                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B isoform X1
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04012  ErbB signaling pathway
mgp04068  FoxO signaling pathway
mgp04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100545308 (CDKN1B)
   04068 FoxO signaling pathway
    100545308 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100545308 (CDKN1B)
SSDB
Motif
Pfam: CDI DUF2742
Other DBs
NCBI-GeneID: 100545308
NCBI-ProteinID: XP_010714503
LinkDB
Position
1
AA seq 198 aa
MSNVRISNGSPTLERMEARQSEYPKPSACRNLFGPVNHEELNRDLKKHRKEMEEACQRKW
NFDFQNHKPLEGRYEWQAVEKGSSPDFYFRPPRLPKAVCRSAGRQSLDVNGNCQTAICAA
SQGISEDTHCVGRKTDVAGSQTDFAEQCAGQRKRPAADDSSPQNKRANTTEEEVSEDSPS
ASSVEQTPKKSSPRRHQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtccgcatttctaatgggagccctaccctggagcgcatggaggcgcggcag
tcggagtacccgaagccgtcggcctgcaggaacctcttcgggccggtaaaccacgaagag
ttaaacagggacttgaagaagcaccgcaaggaaatggaagaggcatgccagaggaagtgg
aatttcgatttccagaaccacaagccgctggaaggcaggtacgagtggcaagccgtggag
aaggggagctcgcccgacttctacttcagaccgccgaggctacccaaagccgtttgcagg
tccgccggccgtcaaagcctggatgtaaacgggaattgccaaaccgcgatttgcgccgct
tctcagggaatctcagaggacactcactgtgtaggccgaaagactgatgttgctggcagt
cagacggactttgcagagcagtgcgccgggcagaggaaaagacccgccgccgacgattcc
tctcctcaaaataaaagagccaacacaacagaagaggaggtttcagaagactcccccagt
gccagttcagtggagcaaacacccaagaaatcgagcccgagacgacatcaaacgtaa

DBGET integrated database retrieval system