KEGG   Meleagris gallopavo (turkey): 100545359
Entry
100545359         CDS       T01523                                 

Gene name
RFC3
Definition
(RefSeq) replication factor C subunit 3
  KO
K10756  replication factor C subunit 3/5
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03030  DNA replication
mgp03420  Nucleotide excision repair
mgp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100545359 (RFC3)
   03420 Nucleotide excision repair
    100545359 (RFC3)
   03430 Mismatch repair
    100545359 (RFC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    100545359 (RFC3)
   03036 Chromosome and associated proteins [BR:mgp03036]
    100545359 (RFC3)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100545359 (RFC3)
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    100545359 (RFC3)
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     100545359 (RFC3)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    100545359 (RFC3)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     100545359 (RFC3)
  Check point factors
   HRAD17(Rad24)-RFC complex
    100545359 (RFC3)
SSDB
Motif
Pfam: DNA_pol3_delta2 DNA_pol3_delta Rep_fac_C AAA ATPgrasp_ST CHB_HEX DUF2247
Other DBs
NCBI-GeneID: 100545359
NCBI-ProteinID: XP_031407916
Ensembl: ENSMGAG00000015069
LinkDB
Position
1
AA seq 304 aa
MCLLRELYGAGVEKLRIEHQSITAPSKKKIEISTIASNYHLEVNPSDAGNNDRVVIQELL
KTVAQSQQLETSTQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMATCRLILCCNSISKII
GPIQSRCLTVRVPAPSIEDICHVLSSVCKKEGLTLPQELAQRLAEKSGRNLRKALLMCES
CRVQQYPFSADQDIPEMDWEIYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIM
KGLLTELLNNCDGQLKGEVAQMAAFYEHRLQLGSKAIYHLEAFVAKFMAIYKKFMEDGLD
DMMF
NT seq 915 nt   +upstreamnt  +downstreamnt
atgtgtttgttaagagaattatacggtgcaggtgtggagaaactgaggattgagcatcag
agtataacggcaccttctaaaaagaaaattgaaattagcacgattgcaagtaattaccac
cttgaagttaacccaagcgatgctggcaataatgaccgtgtagtgattcaggaactcttg
aagacagtagcacaatcccagcaacttgaaacaagtactcaacgagactttaaagtggtg
ctgttaacagaagtcgacaagctcactaaagatgcccagcacgctttgcgaagaacaatg
gagaagtacatggcaacctgcagacttatcctgtgctgcaactccatatcaaaaattata
ggacctattcaaagcaggtgcctgactgtacgagtgcctgctcccagcattgaagatatc
tgtcatgtgttatccagtgtgtgtaagaaagaaggcctgactcttcctcaggaactggct
caaaggcttgcagagaaatctggcaggaatcttcggaaagcactgcttatgtgcgagtct
tgcagagtacaacagtatcctttcagtgctgatcaagatattcctgagatggactgggaa
atttatctgagagaaactgcaaatgcaattgtcagtcaacagacaccacaaagacttcta
gaggttcgtggacggctctatgaactcctaacacactgcattcctcctgagattataatg
aagggtctcctgacagaacttttgaataattgtgatggacaactgaaaggagaagttgca
cagatggcagccttctatgagcaccgcttgcaactgggcagcaaagccatttatcatctt
gaagcatttgtagcaaagtttatggcaatttacaagaaatttatggaggatggactagat
gacatgatgttctaa

KEGG   Meleagris gallopavo (turkey): 100545948
Entry
100545948         CDS       T01523                                 

Gene name
RFC4
Definition
(RefSeq) replication factor C subunit 4
  KO
K10755  replication factor C subunit 2/4
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03030  DNA replication
mgp03420  Nucleotide excision repair
mgp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100545948 (RFC4)
   03420 Nucleotide excision repair
    100545948 (RFC4)
   03430 Mismatch repair
    100545948 (RFC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    100545948 (RFC4)
   03036 Chromosome and associated proteins [BR:mgp03036]
    100545948 (RFC4)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100545948 (RFC4)
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    100545948 (RFC4)
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     100545948 (RFC4)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    100545948 (RFC4)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     100545948 (RFC4)
  Check point factors
   HRAD17(Rad24)-RFC complex
    100545948 (RFC4)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 AAA_assoc_2 AAA_16 Rad17 AAA_22 AAA_11 AAA_30 AAA_19 DUF815 AAA_24 DNA_pol3_delta Mg_chelatase RuvB_N DNA_pol3_gamma3 TIP49_C AAA_5 bpMoxR ResIII DUF2075 AAA_23 AAA_7 AAA_3 AAA_28
Other DBs
NCBI-GeneID: 100545948
NCBI-ProteinID: XP_031411037
Ensembl: ENSMGAG00000009412
LinkDB
Position
11
AA seq 362 aa
MQAFLKGPSSISTKPPAAKERSAAGSSGEGKRLKPIPWVEKYRPKNVDEVAFQDEVVAVL
KKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRQRVLELNASDERGIQVIREK
VKAFAQLTASGSRADGEVCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNY
ISRIIEPLTSRCSKFRFKPLSDKIQQQRLLDVSEKENVKITSEAVSYLVKVSEGDLRKAI
TYLQSATRLMGGKEITEKTVTEIAGVIPRETIDGLLSACWSGSFEKLETVAKNLISEGYA
VAQLISQLHDLVVESEDFSDKQKSIIVEKLAEVDKCLADGADEYLQLISLCALVMQQLTQ
NT
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgcaggccttcctcaaaggcccgtcctccatcagcaccaagcctccagccgccaaggag
aggagcgcggcggggagcagcggggaaggcaagaggctcaaacccatcccctgggtggag
aaatatcgccccaaaaatgtggatgaagttgccttccaggatgaagttgttgctgtgctg
aaaaagtctttggaaggcgctgatcttcccaatctgctgttctatggcccgcctggaact
ggaaagacctccactattttagcagctgcccgagaactctttgggcctgaactattccga
caaagagtcctggagttaaatgcttctgatgaacgtgggatacaagtgatccgtgaaaaa
gtgaaggcttttgctcagctcacagcatctggaagccgagcagatggtgaagtttgtcct
ccttttaagattgtgatcctggatgaagcagactctatgacctcagcagcccaggcagcc
ttaagacgcacaatggaaaaagaatctaaaacaacacgtttttgccttatttgtaactac
atcagcagaataatcgaacctttaacatctcggtgctccaaattccgtttcaaacctttg
tcagacaaaatccagcaacagagactattggatgtttctgagaaggaaaatgtgaaaatc
actagtgaggcagtatcttatcttgttaaagtgtcagagggggacttaagaaaagcaatt
acttaccttcaaagtgccactcgcttgatgggtgggaaggagatcacagagaagactgtc
actgaaattgctggggtcatcccaagagaaacgatagatggactgctgtctgcctgttgg
agtggttcatttgagaaactggaaacagtggcaaagaatcttataagtgaggggtatgct
gttgctcagctcataagccagcttcatgatcttgttgttgagagcgaagacttcagcgac
aagcagaaatcaatcatcgttgagaagcttgcagaagtggacaaatgtttggcagatggt
gctgatgaatacttgcagttgataagtctgtgtgcccttgtgatgcagcagctaacgcaa
aacacctaa

KEGG   Meleagris gallopavo (turkey): 100550696
Entry
100550696         CDS       T01523                                 

Gene name
RFC1
Definition
(RefSeq) LOW QUALITY PROTEIN: replication factor C subunit 1
  KO
K10754  replication factor C subunit 1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03030  DNA replication
mgp03420  Nucleotide excision repair
mgp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100550696 (RFC1)
   03420 Nucleotide excision repair
    100550696 (RFC1)
   03430 Mismatch repair
    100550696 (RFC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    100550696 (RFC1)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100550696 (RFC1)
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    100550696 (RFC1)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     100550696 (RFC1)
SSDB
Motif
Pfam: RFC1 BRCT AAA PTCB-BRCT Rad17 AAA_14 RuvB_N RNA_helicase AAA_22 AAA_5 AAA_33 AAA_16 AAA_18 BRCT_2 AAA_17 AAA_7 AAA_30 NTPase_1
Other DBs
NCBI-GeneID: 100550696
NCBI-ProteinID: XP_019470443
Ensembl: ENSMGAG00000012310
LinkDB
Position
4
AA seq 1156 aa
MAAAPGGGDTKEDIRKFFGVVPPGKQQGCQAVKKSEKXKNGEGESSGKKRGKETKVKSSP
SEDVPKQKQAYKKKRIIYDSDSEEEVQSVXKTKKTSEKKAATPKLGKVLKQHPVVYVSET
DEEDDFVNKRISLKPKENGASAISCPGTAAVKKADVKAQAKAKPLSPVKLTPTSALDYFG
TRSVQRSEKKLVASKRKEPSQSGDSTLDDEAIARQLQLEEDSELERQLHEDEEFARTLAM
LDETPQKKKARRDSGEQTVLSIKSSPNATGRYKQSQRAKATNSAGEVKEQTKSENSKEPN
LHPSVGEIARALTEKTLPLKPTSKLVALKQKEETTKKQSGTQNLLSKEKNAMGKEEKRTP
KKEKISPKKAESISPEDSEKRRSNYQAYRSFLNREGPKALGSKEIPQGAENCLEGLTFVI
TGVLESIERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDCGQSKCEKASALGTKIIDEDG
LFDLVRTMPGKKSKYELAAETEAKKAESRHKKTPQKTESGKRNFSPLKREADRKKSNCTP
EKGGTFKSVKKEATAIRKLKDFEHQTVQKKEAPKSKGTLVSESSENKTETLLWVDKYKPA
SLKAIIGQQGEQSCANKLLRWLRSWYRNTSEDGQAKTNKSGGKDDGSSFKAALLSGPPGV
GKTTTASLVCKELGYSYVELNASDTRSKNSLKEVVAESLNNTSIKGFCSGTSSSVSGKHV
LIMDEVDGMAGNEDRGGIQELIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLRFQRPR
LEQIKGAMMSIAFKEGLKIPPPAMNEIILAANQDIRQVLHNLNMWCAKDKSLTYDEAKTD
AGRAKKDIKLGPFDVVRKVFAAGEEASRMSLIDKSDLFFHDYSLAPLFVQENYVHVKPAA
AGGDLKKHLMLLSRAADSICDGDLVDKQIRTKQNWNLLPTQAIYSSVLPGELMRGYMSQF
PVFPSWLGKFSSTGKHERIIQELAMHMSLRTQACKRTVNMEYLSHLRDALIQPLKAFGAD
GVQDAIAFMDSYCLMKEDIENIMEISMWGGKPSPFSKLDPKVKAAFTRAYNKEVHLTPYS
LHSVKLSRQQSGSMGTSELNGELNVEEIQSEEEEQDTVESDAMIKQKKVKSSKLPKREKN
EETTKKEGKRKEKTRH
NT seq 3471 nt   +upstreamnt  +downstreamnt
atggctgctgcccctgggggtggtgatactaaggaggatatccggaaattctttggcgtt
gtgcctcctggaaagcagcaggggtgccaggctgtgaaaaagagcgagaagnataaaaac
ggggaaggagaatcaagtgggaagaagaggggaaaggaaacaaaggtgaagagttcaccc
agtgaagatgttcccaaacaaaagcaggcatacaagaaaaaaagaataatctatgattca
gattcagaagaggaggtgcagtctgtgnaaaaaaccaagaagacatcagagaagaaagca
gcgactccaaaacttggtaaagttctaaagcagcatcctgttgtctatgtttcagagaca
gatgaagaggatgactttgtcaacaagagaatttccctgaaaccaaaggagaatggggca
tcagcaatcagttgtccaggaacagcagcagtgaaaaaagcagatgtaaaggcacaggct
aaagccaaaccattatctccggtgaaactgactcccacctcagctcttgattactttggg
acaagaagtgtccagcgatcagaaaagaaactggtagcgagtaaaaggaaggaaccttca
caaagcggagacagcacactagatgatgaggccattgctaggcaactgcagcttgaagaa
gattcggagctggagagacagctgcatgaagatgaagaatttgctagaactttggcaatg
ttggatgaaaccccacagaagaaaaaggctcggagagattcgggggagcaaacggtgctg
agcatcaagagcagtcctaatgcgacgggaagatacaaacaatcccaaagagcgaaagca
acaaactcggcaggtgaagtaaaagaacaaactaaatctgaaaattcaaaagagcctaat
ttacatccatctgttggtgaaatagcaagggcactgacggagaaaaccttgcctttgaaa
cctacctcaaagcttgtggctctaaaacagaaggaggagactactaaaaagcaaagtggc
actcaaaacttactatcaaaagaaaaaaatgctatggggaaagaagagaaaagaacaccc
aagaaggagaaaatttctcccaagaaggctgagtctataagtcctgaggactctgaaaag
agacgaagcaactatcaagcctaccgaagcttcctcaatcgcgagggtccgaaagctctg
ggttccaaagagattcctcaaggagctgaaaactgcttggaaggcctgacgttcgtaatt
acaggagttctggagtccattgaaagagatgaggccaagtctctgattgaacgatacgga
ggaaaagtaactggcaatgtcagcaagaagacaaactatctggttatgggacgagactgc
ggacagtctaaatgtgaaaaggcatcagctttagggacaaaaattattgatgaggatggc
ctatttgatcttgttcgaacgatgccaggcaagaagtccaagtatgagctggcagctgaa
acagaggcaaagaaggcagagtcaagacataaaaagacaccacagaaaactgagtctggc
aaaaggaattttagtcctctcaaaagggaagctgataggaagaaaagtaattgtacacct
gaaaagggaggtaccttcaaatctgtcaagaaagaagctactgccattcgaaagcttaag
gactttgaacatcaaactgtgcagaagaaagaagcccccaaatctaaggggaccttggtt
tctgagagcagtgaaaataaaacagagacattactatgggtagataaatacaagcctgca
tctcttaaggcgataattggacagcagggtgagcagagctgtgccaataaactcctccga
tggcttcgaagctggtacaggaatacctcagaagatggacaagcaaagaccaacaaatct
ggaggcaaagatgatggttctagttttaaagcagcattgctctctggtccacctggagtt
ggtaaaactaccacagcttctttagtttgtaaggaactggggtacagctatgtggagctg
aatgccagtgacactcgaagtaagaacagtctaaaggaagtagttgctgaatcactgaac
aacaccagcatcaaaggcttctgttctggcacatcctcatcagttagcgggaaacatgta
ttgatcatggatgaagtggatggtatggcaggcaatgaagacagaggagggattcaggaa
ctgattggtttgattaaacacacaaagatacccatcatctgtatgtgtaatgaccgaaac
catccgaaaattcgttccttggtccactattgttttgatcttcgttttcagagacctcgt
ctagaacagattaagggtgccatgatgtctattgcatttaaagaaggtttgaaaattcca
ccacctgctatgaacgagataatcctggcagcaaatcaagacatcagacaggttttgcat
aatctcaatatgtggtgtgcaaaagataaatcattgacttacgatgaggccaaaacagac
gctggcagagccaaaaaggatatcaaactgggcccttttgatgttgtccggaaagttttt
gctgctggagaggaggcttctcgtatgtctcttatagacaaatcagatctcttcttccat
gactattccctagcacctctctttgtccaagagaactatgtgcatgtgaaacctgctgct
gctggaggagatttgaagaaacacttgatgctcttgagtagagctgctgatagtatatgt
gatggtgatctggtggacaaacagattcgtaccaagcaaaactggaaccttctaccgaca
caggctatttattcgagtgttcttcctggggagctgatgagaggttacatgtcccagttt
cctgtctttcccagctggctggggaaattttcatccacgggcaaacacgaacgtatcatc
caagaactggcaatgcacatgagtctgagaacccaagcatgcaagaggacagtaaatatg
gaatatttgtcacatctgcgtgatgcactcatccagccactgaaagcctttggagcagat
ggggtacaagatgctatagcattcatggactcttactgcctgatgaaagaagacattgaa
aacataatggaaataagcatgtggggaggtaaacccagtcctttttcaaagctggatccc
aaggtcaaggcagcttttacacgtgcctacaacaaagaggtgcatctgactccatattcc
cttcattctgtgaagttgtcaagacagcagtcaggatccatggggacctctgaactgaac
ggagaactgaatgtggaagagatccaatctgaggaggaggagcaagatactgttgaaagt
gatgcaatgatcaagcaaaaaaaggtgaagtcttccaagctgccaaaaagagagaaaaat
gaagaaacaacaaaaaaagaaggtaaaagaaaagagaaaacaagacattaa

KEGG   Meleagris gallopavo (turkey): 100551274
Entry
100551274         CDS       T01523                                 

Gene name
RFC5
Definition
(RefSeq) replication factor C subunit 5
  KO
K10756  replication factor C subunit 3/5
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03030  DNA replication
mgp03420  Nucleotide excision repair
mgp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100551274 (RFC5)
   03420 Nucleotide excision repair
    100551274 (RFC5)
   03430 Mismatch repair
    100551274 (RFC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    100551274 (RFC5)
   03036 Chromosome and associated proteins [BR:mgp03036]
    100551274 (RFC5)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100551274 (RFC5)
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    100551274 (RFC5)
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     100551274 (RFC5)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    100551274 (RFC5)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     100551274 (RFC5)
  Check point factors
   HRAD17(Rad24)-RFC complex
    100551274 (RFC5)
SSDB
Motif
Pfam: Rep_fac_C DNA_pol3_delta2 AAA AAA_assoc_2 DNA_pol3_delta DEAD Hydantoinase_B Thioredoxin_6
Other DBs
NCBI-GeneID: 100551274
NCBI-ProteinID: XP_010718814
Ensembl: ENSMGAG00000005560
LinkDB
Position
17
AA seq 255 aa
MVLELNASDDRGIDIVRGPILSFASTRTIFKKGFKLVILDEADAMTQDAQNALRRVIEKF
TENTRFCLICNYLSKIIPALQSRCTRFRFGPLTPELMVPRLQHVIQEEGVDVSEDGMKAL
VTLSSGDMRRALNILQSTSMAFGKVTEENVYTCTGHPLEADITNILDWMLNQNFSTAFRK
IMELKTLKGLALQDILTEIHLFVHRVDFPPSVRIQLLIKMADIEYRLAAGTSEKVQLSSL
IAAFQVTRDLIVAEA
NT seq 768 nt   +upstreamnt  +downstreamnt
atggtgctggagctgaatgcatcggatgaccgtggcatcgacatcgttcgagggcccatc
ctgagctttgccagcaccaggaccatcttcaagaaaggcttcaagctcgtcatcctggat
gaagctgatgccatgacacaggacgcacagaacgctctgcggcgagtgatcgagaagttc
accgagaacacacgcttttgcctcatctgcaactacctctccaagatcatccccgccctg
cagtcccgctgcacccgcttccgcttcgggcccctcaccccagagctgatggtgccccgg
ctgcagcacgtcatccaggaggagggggtggacgtgagtgaggatgggatgaaggcactg
gtgaccctctcgagcggtgacatgcgcagagccctcaacatcctgcagagcacctccatg
gcctttgggaaagtgacggaggagaatgtctacacctgcacgggacaccccctcgaagct
gacatcaccaacatcctcgactggatgctcaaccagaacttctccaccgccttccgcaaa
atcatggagctgaagacactgaagggcctggctctgcaggacatcctcaccgagatccac
ctctttgtgcacagagttgatttcccaccctcagtccgcatccagctgctgatcaagatg
gcagacattgagtaccggctggctgcaggcaccagcgagaaggtgcagctgagctccctc
atcgcagcattccaggtcaccagggacctgattgtggccgaagcatga

KEGG   Meleagris gallopavo (turkey): 100551330
Entry
100551330         CDS       T01523                                 

Gene name
RFC2
Definition
(RefSeq) replication factor C subunit 2
  KO
K10755  replication factor C subunit 2/4
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03030  DNA replication
mgp03420  Nucleotide excision repair
mgp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100551330 (RFC2)
   03420 Nucleotide excision repair
    100551330 (RFC2)
   03430 Mismatch repair
    100551330 (RFC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    100551330 (RFC2)
   03036 Chromosome and associated proteins [BR:mgp03036]
    100551330 (RFC2)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100551330 (RFC2)
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    100551330 (RFC2)
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     100551330 (RFC2)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    100551330 (RFC2)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     100551330 (RFC2)
  Check point factors
   HRAD17(Rad24)-RFC complex
    100551330 (RFC2)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 AAA_14 AAA_16 AAA_22 Viral_helicase1 AAA_11 AAA_24 Mg_chelatase Rad17 AAA_19 AAA_assoc_2 AAA_18 MipZ AAA_25 RuvB_N AAA_5 DEAD ABC_tran AAA_30 AAA_28 NTPase_1 MeaB FtsK_SpoIIIE AAA_23 T2SSE RNA_helicase
Other DBs
NCBI-GeneID: 100551330
NCBI-ProteinID: XP_003211707
Ensembl: ENSMGAG00000002487
UniProt: G1MUA0
LinkDB
Position
21
AA seq 360 aa
MEEEEEVVEVMEDEKAGPAAAEKRGPADSLGSAPAAGGHYELPWVEKYRPLKLCEVVGNE
DTVSRLEVFAKEGNVPNIIIAGPPGTGKTTSILCLARALLGPALKDAVLELNASNDRGID
VVRNKIKMFAQQKVTLPKGRHKIIILDEADSMTDGAQQALRRTMEIYSKTTRFALACNAS
DKIIEPIQSRCAVLRYTKLTDSQILARLLKIVEKEDVPYTDDGLEAIIFTAQGDMRQALN
NLQSTYSGFGFINSENVFKVCDEPHPLLVKEMIQHCINANIDEAYKILAHLWRLGYSPED
VIGNIFRVCKTFQMPEYLKLEFIKEIGYTHMKIAEGVNSLLQMAGLLARLCQKTAAPAAS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggaggaagaggaagaagtggtggaggtcatggaggacgagaaggccgggcccgcggcc
gctgagaagcggggaccagccgactcgctcgggtccgcccctgctgccggcggccattac
gagctgccctgggtggaaaaatacagacctctgaaactgtgtgaagtagttggaaacgaa
gatacagtgagcaggctggaggtctttgcaaaagaagggaatgtcccaaatattatcatt
gcgggtccccctggaacgggaaaaaccaccagcatcctctgcttggctcgtgctctgctt
ggccctgcattaaaggatgctgttttggagctgaatgcctcaaatgacagaggcatcgat
gtagtgagaaacaaaatcaaaatgtttgctcagcaaaaggtcacacttccaaaaggtcgg
cacaaaattatcatcctcgatgaagcagacagcatgacagatggagcacagcaagcattg
agaaggacaatggaaatctattccaaaacaacgcgcttcgcactcgcatgcaatgcctct
gataaaatcatagagcctattcagtctcggtgtgcagtgctgcgttacaccaaactgaca
gattcacagatccttgcaaggctactgaaaattgttgaaaaagaggatgtaccatatact
gatgatggattagaagccattatcttcacagctcaaggagatatgagacaggccttaaac
aacttacagtccacatattctggatttggttttataaacagtgaaaacgtctttaaggta
tgtgacgagcctcaccctctgcttgtgaaagaaatgatacaacactgcataaatgcaaat
attgatgaagcatacaagattcttgcccacctatggagacttggatactctccagaagac
gtgattggcaacatcttccgtgtgtgtaaaacctttcaaatgccagaatatctgaagctg
gaatttatcaaggaaattggctacacgcatatgaagatagcagaaggtgtgaactcactg
ctacaaatggctggactgcttgccaggctgtgtcagaagactgcagctcctgcagcaagt
tag

DBGET integrated database retrieval system