KEGG   Meleagris gallopavo (turkey): 100545555Help
Entry
100545555         CDS       T01523                                 

Gene name
KMT2E
Definition
(RefSeq) lysine methyltransferase 2E
  KO
K09189  histone-lysine N-methyltransferase MLL5 [EC:2.1.1.43]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mgp00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100545555 (KMT2E)
Enzymes [BR:mgp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100545555 (KMT2E)
Transcription factors [BR:mgp03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    100545555 (KMT2E)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100545555 (KMT2E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PHD SET PHD_2
Motif
Other DBs
NCBI-GeneID: 100545555
NCBI-ProteinID: XP_010722598
Ensembl: ENSMGAG00000006621
LinkDB All DBs
Position
1
AA seq 1814 aa AA seqDB search
MSIVIPLGVDTADTSYLEMAAGSEPESVEASPVVVEKSNSYPHQLYTSSSHSHSYIGLPY
ADHNYGARPPPTPPASPPPSVVISKNEVGIFTTPNFDETSSATTISTSEDGSYGTDITRC
ICGFTHDDGYMICCDKCSVWQHIDCMGIDRQHIPDIYLCERCQPRNLDKERAVLLQRRKR
ENMSDGDTSATESGDEVPVELYTAFQHTPTTFTIASPRVTKVNDKKRKKSGEKEQNIAKC
KKAFREGSRKSSRVKGSAPEIDPTDSSNFGWETKIKAWMDRYEEANNNQYSEGVQREAQK
IALRLGNGNDKKEVSTSNLIFKPPVESYVQKNKKILKAAKDLPPDALIIEYRGKFMLREQ
FEANGYFFKRPYPFVLFYSKFHGLEMCVDARTFGNEARFIRRSCTPNAEVRHVIEDGTIH
LYIYSIHNIPKGAEITIAFDFDYGNCKYKVDCACLKENPECPVLRRSEPTENINTGYETR
RKKGKKEKDVSREKETQNQNITLDCEGAATKMKIADNKQRKLSPLRLSISNNQEPDFIDD
IEEKTPISNEVEMESEEQIAERKRKMTREERKMEAILQAFARLEKREKRREQALERISTA
KTEVKSECKEPQILNDTEFIQEPAKEEAVTKPAPAKVNRAKQRKSFSRSRTHIGQQRRRH
RTVSMCSDIQPSSPDVEVTSQHNETENAALVAEPETETVVTEMVTETEAPALNKCPTKYP
KTKKHLVNEWLSEKSDKTGKPTDSVSERPLRITTDPEVLATQLNSLPGLTYSPHVYSTPK
HYIRFTSPFLSEKRRKKEPVENMSGSCKKRWLKQALEEENSTVIDRFNSPSLEGSRSPAI
NGENKSPLLLNDSCSLTDLTTPLKKRRLYQLLESAFSETSTPTPSPYATPTHADIAASEP
LMFATPPRAKTEDEACRNGYKPIYSPVTPVTPCIHGNTMHFENISSPDSSPEIKRRAYTQ
EGYDRASILALNSFRNSNLTEMGLQEIKTIGYSSPRNRTDATRQCTGEMESVSDLQLGLE
VIEQSTLHKNLEAPTHDRTDSSSQLETAHCGRGTIYSSWVKSPDRTGVNFSMNSNLRDLT
PSHQLEVGGGFRISESKCLIQDDARGMFMEASVFCTSEDGIASGFGRTVNNDNLMDGNCT
PQNPPQKKKVSLLEYRKRQREARKSGSKTENFPLVTVSPHAAGGGNLSSNSGANDGFNNS
GENGEQTDNAASVPVPLPTAVYNAAPEDVGNNSATKETSSSEKNEPEVQWTASTSVEQVR
ERSYHRALLLSDHRKDKDCEPDPENPEPTSECPSPDTSQKTCKSPSKASKPSSPSPVVSA
SSLGKTPTKPDSHWDTAANAPEAEGVNHPKSELQQKQLTNNVQALSKTHPSQSHLRSSAE
QLSHSQKLPSAPLKLHCPPSPHVENPPKPSTPHAPVQHGYLSPKPHSQQLGSPYRPHHPQ
SPQVGTPQRETHRGFYPAAPSLQPSNQQQASGPLFAQTASGQSSASYSQFNQQNLNSNAP
PPPPPPPPSSTYYQNQQPSGNFQSYSQLKGSIPQQTVFSSGPNQALPGSAGQQTVPGHHV
TAGHFLPSQTPSIHHQASASAAPPPPPPPPAPGPHLVQQQSTHQQHSVAHVVGPVHAVAV
APGSHIHSQAAGHHLPPPPPPPGPIPHHQPPHPPAGHQGLQAQHQHVVNSAPPPPPPPPS
NVIGSGHHPASAQGLHHPSHQGPPHFPSGAHTSVSSYSSQAPHHTTLGPGPQHQPAGTGP
HCPLPGQGPHIQPQGPNSIATPTASGFCPHPGSVTLPHAVQGPQQASPVPGQIPIHRAQV
PPTFQNNYHGSGWH
NT seq 5445 nt NT seq  +upstreamnt  +downstreamnt
atgagcatagtgatcccactgggggttgacacagcagatacttcttatttggaaatggct
gcaggctcagaaccagaatctgtagaagctagccctgtggtagttgaaaaatcgaacagt
tatccgcaccagttgtataccagcagctcgcattcacacagctatattggtttgccctat
gcagaccataactatggtgctcggcctcctccaacgcctccagcttctcctcctccatca
gtagttataagcaagaatgaagtaggcatatttaccactcccaactttgatgaaacctcc
agtgctactaccatcagtacatcagaggatggaagctatggaactgatattaccagatgc
atttgtggctttacgcatgatgatggatatatgatctgttgtgacaaatgcagtgtctgg
caacacattgactgtatgggaattgacagacagcatattcctgacatatatctgtgtgaa
cgttgtcaaccaaggaacttggataaggaaagggcagtgctattgcagaggaggaaaagg
gaaaatatgtcagatggggataccagtgcaacagagagtggtgatgaagttcctgtggaa
ctgtatactgcttttcaacacacaccaactacatttacaatagcttctccaagagttaca
aaggtcaatgataagaagaggaaaaaaagtggggagaaagagcagaacatagcaaaatgt
aaaaaagcatttcgagaaggatccagaaaatcttcaagagtaaagggctcagctccagag
attgatcctactgacagttcaaactttggatgggaaactaaaatcaaagcatggatggat
cgttacgaagaggcaaataataaccagtacagtgaaggtgttcagagggaggcacaaaaa
atagctctgagattaggcaatggaaatgacaagaaagaagtcagcaccagcaatctgatt
ttcaaacctccagtagagagttacgtgcaaaaaaacaagaaaattttaaaagctgccaaa
gacttgcctcctgatgcacttattattgaatacagaggaaagttcatgctgagagaacag
tttgaagctaacggatatttctttaaaaggccatatccatttgttttattttattccaag
tttcacgggctagaaatgtgtgttgatgcaaggacttttggaaacgaagctcggttcatc
cggcgttcatgtacaccaaatgcagaggtgaggcatgtaattgaagatggaacgattcat
ctttatatttactccatccataacattccaaaaggagcagagattactatagcatttgat
tttgattatggaaattgtaaatacaaagtggactgtgcttgcctcaaagaaaatcctgaa
tgtccagttctcagacgttctgagcctacagaaaacatcaatactggatatgaaaccaga
aggaaaaagggaaagaaagagaaggatgtttcaagagaaaaggagactcaaaatcagaac
atcacattggactgtgaaggagcagccaccaaaatgaaaattgcagataataagcagagg
aagctctctccccttaggctgtccatttccaataaccaggagccagattttattgatgat
atagaagaaaaaactcccattagcaatgaagtagaaatggaatcagaggagcagattgca
gagaggaaaaggaagatgacaagagaagaacggaaaatggaagctatcttgcaagctttt
gccagattagaaaaaagagaaaaaagaagagaacaggctttggaaaggatcagcacagca
aaaactgaggttaaatcagaatgcaaggaaccacagattctcaatgacactgaatttatt
caggaaccagcaaaggaagaagctgtcactaagcctgccccagccaaggttaatagagcc
aaacagagaaaaagcttctctcgaagcagaactcatattggacagcagcgtagacggcac
agaactgtgagcatgtgttcagatattcagccatcttctcctgatgtggaagtaacgtca
caacataatgagactgagaatgctgcactggtggctgagccagaaacagaaactgttgtt
acagaaatggttaccgaaacagaagctccagcacttaataaatgtcctactaagtatcct
aaaacaaagaagcacttggtaaatgaatggttaagtgaaaagagtgataagacagggaag
cctacagacagtgtttcagaaaggcctctgcgtataaccaccgaccctgaagttctggct
actcaactgaattctctaccaggtctcacttacagcccacatgtatactctactccaaag
cactatattcgtttcacttcaccattcctttcagaaaagaggaggaaaaaggaacctgtg
gaaaacatgtccggctcttgtaagaagcgttggttgaagcaggctttggaagaagaaaac
tcaacagtgattgatagatttaattcgccatcgctagagggatctagaagtccagccatc
aacggtgaaaataaaagccctttattactgaatgacagctgttccttaacagatctaaca
acacctctaaaaaaacgaagactgtaccagctgttggagtctgcattctcagaaacctct
acacctactccttctccatatgccacaccaactcatgctgacattgctgcctcagagcca
ttgatgtttgctactcctcctagggcaaaaacagaggatgaagcttgtagaaatggttac
aaacccatttattcaccagttactcctgtaactccgtgtatacatggaaataccatgcac
tttgagaatatttcctcacctgacagttccccagaaataaaaaggcgagcttacactcag
gagggatatgacagagcatcgattctagcactgaattctttcagaaattccaacctgaca
gaaatgggcctgcaggaaataaagactattggatattccagtccaagaaacaggactgat
gcgacacggcagtgcacaggagaaatggaatctgtgtcagacctccagctgggactcgaa
gtaattgagcaaagcacactgcataaaaacctggaagcccctacacatgataggactgat
tcaagcagccaattagaaactgctcattgtggacggggcacaatttattcttcctgggta
aaaagtcccgacaggacaggtgtaaatttctcaatgaattctaatttgagggacttgacc
ccttcacatcagttggaggtaggaggtggattcagaataagtgagtcaaagtgcctgatt
caagacgatgctagaggcatgttcatggaagcatctgttttttgtacttcagaagatgga
attgcatctggctttggaaggactgtcaataatgacaacttgatggatgggaattgcaca
ccccagaatcctccacagaagaaaaaggtatccttgctagaataccgtaagagacaacga
gaagctagaaaaagtggctcaaagacggaaaactttcccctggttactgtatctcctcat
gctgctggtggaggaaacctaagtagtaacagtggtgctaatgatgggtttaacaacagt
ggtgaaaatggggagcaaactgataatgctgcaagcgtgcctgtaccactgccaactgct
gtttataatgcagctcccgaagacgtgggcaacaacagtgcaaccaaggaaacttcttcc
agtgagaagaacgagcctgaggttcagtggaccgcatcaacctctgtggaacaagtgaga
gaacgaagttatcatagagctttgcttctcagtgatcataggaaagacaaggactgtgaa
cctgatcctgaaaatccagagcctacttctgaatgtccatccccagatacttcacagaag
acgtgcaagagtccttcaaaagcaagcaagccctcttcgccgagtcctgtagtttcagcg
tcatcactgggaaaaacacccaccaagccagattcgcactgggacactgcagccaatgca
ccagaggccgaaggtgtgaatcatccaaaatcagagctgcaacaaaaacagctgacaaat
aacgtccaagcactttcaaaaactcatccatctcaatcacatctgcgcagttctgctgag
caactttcacattcacagaagttgccttccgcacctttgaagctccattgtcccccttcg
cctcacgtagaaaatcccccgaagccatcgacgccccacgcgcccgtgcagcacggttat
ctctcaccaaagcctcactcgcagcagttgggatctccatacagacctcatcatccacag
tcacctcaagtcggaacgccccagagggaaacgcaccgtggtttctatcccgcagcgcca
agccttcagcccagtaatcagcagcaggccagcgggccgctgttcgctcagacagcttca
ggacaatcctcggcttcttacagccagttcaaccaacagaatctgaacagcaatgcgcca
cctcccccacctcctccacccccttcttccacctactatcagaaccagcagccctctgga
aactttcagagttatagtcagctgaagggtagcatcccccaacagactgtgttttcatcc
ggaccaaatcaagcgcttcctggctctgcgggtcagcagacagtgccgggacaccacgta
accgcaggccatttcttgccctctcagacccccagtattcatcaccaggcttcagcgtct
gccgctcctcctcctcctccgccgccccctgctcccggccctcacctggttcagcagcag
agcacccatcagcagcattctgtagcacacgtcgtcggcccggttcacgctgtggcggtg
gctcccggatctcacattcactctcaagctgccggtcaccatctgccacccccgcctccg
ccaccgggccccatcccccaccaccagcctcctcatcctccggccggacaccaaggtttg
caagcacaacaccagcacgttgtaaactctgctcctcctccccctccgcctcccccgtcc
aacgttataggctcggggcaccacccggcgtcggcacaagggttacaccacccatcgcat
caaggacccccccattttccctcaggcgctcacacgagcgtgtcctcctattcctcgcaa
gccccccaccacacgacgttaggacccggacctcaacatcagcctgctggaacagggcct
cattgtccgctccccggtcagggtccccacatccaacctcaaggaccaaacagtattgca
acccccaccgcttcagggttctgcccgcaccctggctcagtaacgctcccgcacgcagtg
caaggaccgcagcaggcgtcaccggtgcccggacagatccccattcacagagcacaggtg
ccgcccacctttcagaacaattaccatggttcagggtggcattaa

DBGET integrated database retrieval system