KEGG   Meleagris gallopavo (turkey): 100545569
Entry
100545569         CDS       T01523                                 

Gene name
SESN1
Definition
(RefSeq) sestrin-1 isoform X2
  KO
K10141  sestrin 1/3
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100545569 (SESN1)
SSDB
Motif
Pfam: PA26 CMD
Other DBs
NCBI-GeneID: 100545569
NCBI-ProteinID: XP_010705771
Ensembl: ENSMGAG00000013478
LinkDB
Position
2
AA seq 487 aa
MRVGRPGPQQQELGIRIPRPLGHGPSRFIPEKETIQVGSEDAMMHTLFADSFATLGRLDN
VTLVMVFHPQYLESFLKTQHYLLQMDGPLPLHYRHYIGIMAAARHQCSYLVNLHVNDFLH
VGGDPKWLNGLENAPQKLQNLGELNKMLAHRPWLITKEHIEQLLKTEENSWSLAELIHAV
VLLTHYHSLASFTFGCGISPEIDCEGGHTFRPPSVSNYCLCDITNGYHGVDDIHASPAAS
IPTTESVCEVEALMEKMKQLQECRDEEEASQEEMATRFEREKRESMFVCSSEDEESAPTR
DVSRHFEDTSYGYKDFSRHGMHVPTFRAQDYSWEDHGYSLVNRLYPDVGQLLDEKFHIAY
NLTYNTMAMHKDVDTSMLRRAIWNYIHCMFGIRYDDYDYGEINQLLDRSFKVYIKTVVCT
PEKTTKRMYDSFWRQFEHSEKGQTTLPPLPLLTTPSAPQVHVNLLLVEARMQAELLYALR
AITRYMT
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgagggtgggcaggccgggcccccagcagcaggaactcggcataagaattcctagacca
ctgggacacggaccaagcagattcatcccagagaaggagaccattcaagtgggaagtgaa
gacgccatgatgcacacgctgtttgcagactctttcgctacgctgggccgactggacaac
gttaccttggtgatggttttccacccacagtatctggaaagctttctgaaaactcagcac
tatctgctgcagatggacggcccgctccctcttcattaccggcactacatcgggatcatg
gctgcagccagacatcagtgctcttatcttgttaacctccatgtgaatgacttcctgcat
gttggtggagaccccaaatggttgaacggcctggaaaatgcaccacaaaaactgcagaat
ttgggagaactgaacaaaatgttggctcaccgaccctggcttatcaccaaggagcatatc
gagcaacttttgaagacagaagagaacagctggtccttggcagagctgatccacgctgtt
gttctgctgacacactaccactcccttgcttccttcacgtttggctgcggaatcagccca
gagatcgactgcgaaggcggtcacaccttcaggccaccttctgtcagcaactactgcttg
tgtgatatcacaaatggctaccacggggtggatgacattcatgccagcccagctgcaagt
attccgaccacagaatctgtctgtgaagttgaagctcttatggagaaaatgaagcaactg
caggagtgcagagatgaagaggaagccagccaggaggagatggctacacgttttgaaaga
gagaagagagaaagcatgtttgtgtgttcttcagaagatgaagaatcggcaccaacaaga
gatgtgtctcgtcactttgaggacaccagctatggttacaaggacttctccagacacggg
atgcacgtgcccacctttcgagctcaggattactcttgggaagaccacggctattccttg
gttaatcgtctttacccagatgtgggacagctacttgatgagaagtttcacattgcttat
aatctgacttacaacacaatggccatgcacaaagatgtggatacctcaatgctaagacga
gctatttggaactatattcattgtatgtttggaataagatacgatgattatgactatggt
gaaattaatcagttgttggaccgcagctttaaagtttatatcaagactgtggtttgcact
cctgaaaagaccacaaaaagaatgtatgatagcttctggaggcagtttgaacactctgag
aaggggcaaacgaccttaccacctcttcctttgctaacaaccccctccgctccacaggtc
catgtaaatttgcttctggtagaagctcggatgcaagccgaactactttatgctctgaga
gctattactcgctatatgacctga

KEGG   Meleagris gallopavo (turkey): 100546334
Entry
100546334         CDS       T01523                                 

Gene name
SESN3
Definition
(RefSeq) sestrin-3
  KO
K10141  sestrin 1/3
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100546334 (SESN3)
SSDB
Motif
Pfam: PA26 CMD PEX11 KIP1
Other DBs
NCBI-GeneID: 100546334
NCBI-ProteinID: XP_010704394
LinkDB
Position
1
AA seq 461 aa
MTLLQEKRVQVSPPLTRGPSAFIPENEVMQANGLDERTNLLVEEYSTSGRLDNITQVMSI
HTQYLESFLRSQFYMLRMDGPLPLPYRHYIAIMAAARHQCSYLINMHVDEFLKTGGIAEW
LNGLEYIPQRLKNLNEINKLLAHRPWLITKEHIQKLVKTGENNWSLPELVHAVVLLAHYH
ALASFVFGSGINPERDPDTSNGVRLIAVNNFCVCDLANDNNIENASLTSSNFGIADSLSE
LEALMERMKRLQEDKEDEEASQEEMDTRFEKEKKESLLVISGAFDDEIVSTDVSRYVEDP
GFGYKDFARRGEDHLPTFRAQDYTWENHGFSLVNRLYSDIGHLLDEKFRMVYNLTYNTMA
THEDVDTTTLRRALFNYVHCMYGIRYDDYDYGEVNQLLERSLKVYIKTVTCYPERTTKRM
YDSYWRQFKHSEKVHVNLLLMEARMQAELLYALRAITRHLT
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgactcttctgcaggaaaaaagagtccaagtctctccaccattaacaagaggaccaagt
gcctttatacctgagaatgaggtgatgcaagcaaatggtttggatgaacgtactaatctt
cttgtggaagaatactctacatctggccgcctggacaacatcacacaggtcatgagtatc
cacacgcagtacctggagtctttcctccgcagccagttctacatgctgcgcatggatggg
ccccttcctttgccatataggcactacattgctataatggccgctgccagacatcagtgt
tcctacctaataaatatgcatgttgatgagtttttgaagactggtggtattgcagaatgg
ttgaacggtttagaatacattccccaaaggctgaaaaatctgaacgaaataaacaaactc
cttgcacaccggccctggctgatcacgaaagagcacattcagaaacttgtcaagactggg
gaaaataattggtctcttcctgaactggtgcatgctgttgtcctgttggcacattatcat
gccttggcaagttttgtatttggtagtggcattaatccagagagagatccggatacatct
aatggagtcagacttatagcagtcaacaacttctgtgtctgtgatcttgccaatgacaac
aacatagaaaatgcatccctcacaagtagcaactttgggattgcagattccttaagtgag
ctggaggccttgatggagaggatgaagaggctgcaagaagataaagaagatgaagaagcc
tctcaggaagaaatggacactcgctttgagaaggagaagaaggagagtctgctagtaatt
agtggagcatttgatgatgaaatagtttctacagatgtctcccgctacgttgaagatcct
gggtttgggtacaaagactttgcacggcgaggagaagaccatctgccaacattcagagct
caggactatacttgggaaaatcatggcttttcccttgtaaacaggctttattctgatatt
gggcatctcctcgatgaaaagttccggatggtgtataacctcacgtataacactatggca
acacatgaagatgttgatacaactacgttaagaagagctttatttaactatgtccactgt
atgtatggaatcaggtatgatgactatgattatggagaagttaatcagctacttgaacgc
agcctgaaggtttacataaagacagtgacctgctacccagagagaactaccaagcgcatg
tacgatagttactggcgtcagttcaagcactcggagaaggttcacgtcaatctacttcta
atggaagctcgtatgcaagcagaacttctgtacgcccttcgtgccataactcgtcactta
acctga

KEGG   Meleagris gallopavo (turkey): 104912103
Entry
104912103         CDS       T01523                                 

Definition
(RefSeq) sestrin-3-like
  KO
K10141  sestrin 1/3
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    104912103
SSDB
Motif
Pfam: PA26 CMD Leptin
Other DBs
NCBI-GeneID: 104912103
NCBI-ProteinID: XP_010713285
LinkDB
Position
9
AA seq 423 aa
MSGGEPERPQFLFVKALASRGRLEAVTQQMGYHPRYLDSFLKTQHYLLHMDGPLPFDCRH
YIAIMAAARHHCRYLVNLHVLQFLRAGGDPQWLRGLDFIPPKLRNLNEINKILAHRPWLI
TKEHIEKLLKISEWSWSLAELVHAVVLLAHCHALASFVFGCGCEQEEGPGGRGSLKPSSP
GNQCFCEAAMGNGCGQELLRINRKRSLDSCMELDSLRERVQRIHVETEGREETRPLPPDR
EEDTDGEVTGAANLACYLQDPDFGYQDFARRDEEQTQVFRVQDYSWEDHGFSLVNRLYSD
IGHLLDEKFRMVDGLQSSAMAKRQGCEPSVFKRGIWNYIHCMFGIRYDDYDYAEVNHLLE
RMLKVYIKTVTCYPEKTNPEMFDRFWKQFKHSEKVHVNLLILEARMQAELLYALQAITQY
MVS
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgtccggtggcgagcccgagcgccctcagttcctctttgtgaaggctctggcgagccgg
ggccggctggaggcagtgacccagcagatgggctaccacccgcgctacctcgacagcttc
ctgaagacgcagcactacctgctgcacatggacggcccgctgccctttgactgccgccat
tacatcgccatcatggcggccgcgcgtcaccactgccggtacctggtgaacctccacgtg
ctgcagttcctgcgggcggggggggatccccagtggctgcgtggtctcgatttcatcccc
cccaaactgcgcaacctcaacgagatcaacaagatcctggcgcacaggccttggctcatc
accaaggagcacatcgagaagctgctgaagatcagtgagtggagctggtcgctggcagag
ctggtgcacgccgtcgtcctcctggcgcactgccacgcgcttgccagcttcgttttcggc
tgtggttgtgagcaggaggaggggccggggggcaggggctcgctgaagccctcttcacct
gggaaccagtgcttctgcgaggccgccatggggaacggctgcgggcaggagctgctgcgc
atcaaccgcaaaaggtccctggactcctgcatggagctggactcgctgcgggagcgcgtt
cagaggatccacgtggagactgagggcagggaggagacgaggccgctgccaccggaccgc
gaggaagatactgacggggaggtcaccggtgcagccaacctcgcgtgctatctgcaggac
cctgactttgggtaccaggactttgcgcggcgcgacgaggagcagacgcaggtattcaga
gtccaggattactcctgggaagaccatggcttttcactggtgaaccggctctactctgac
atcgggcatctcctggatgagaagtttcgcatggtggatggtctgcagagcagtgccatg
gccaagcggcagggctgtgaaccctcagtcttcaagcggggcatctggaactacatccac
tgcatgtttggcatcaggtacgatgactatgactatgcagaagtgaatcatctattggag
cgaatgctgaaagtttacattaaaacggtaacctgctacccagagaagacaaacccagaa
atgtttgacaggttctggaagcagttcaagcacagcgaaaaggtccatgtgaacctgctt
attctggaggccaggatgcaggcagagctgctgtatgcactgcaggccatcacccagtac
atggtctcgtag

DBGET integrated database retrieval system