KEGG   Meleagris gallopavo (turkey): 100545829
Entry
100545829         CDS       T01523                                 

Gene name
CCNE2
Definition
(RefSeq) G1/S-specific cyclin-E2 isoform X1
  KO
K06626  G1/S-specific cyclin-E1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04110  Cell cycle
mgp04114  Oocyte meiosis
mgp04115  p53 signaling pathway
mgp04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100545829 (CCNE2)
   04114 Oocyte meiosis
    100545829 (CCNE2)
   04115 p53 signaling pathway
    100545829 (CCNE2)
   04218 Cellular senescence
    100545829 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    100545829 (CCNE2)
   03036 Chromosome and associated proteins [BR:mgp03036]
    100545829 (CCNE2)
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100545829 (CCNE2)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100545829 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100545829
NCBI-ProteinID: XP_010707443
Ensembl: ENSMGAG00000012093
LinkDB
Position
3
AA seq 407 aa
MSRRSSRLQAKQQQQPPLSCQEETPRDLQAPEHLQSRKRRTAEQEFKKKEDGKVAKKHQY
EIKSCWPPAITGGISPCIIIETPHKESVTTDFSRFKKYRFRNLFINPSPLPELTWGNSKD
VWLNILKKENRYAHCKHFTSLHSSLQPHMRSILLDWLLEVCEVYALHRETFYLAQDFFDR
FMLTQKNINKSMLQLIGITSLFIASKLEEIYAPKIQEFAYVTDGACSEDDIVRMELIMLK
ALKWELCPVTIISWLNLYLQVDALKDVPKVLLPQYSQEKFIQIAQLLDLCILDVNSLDFQ
YRTLAAAALCHYTSTEVVKKASGLDWDSISECVEWMVPFVNVARKVSVKLKHFKKVAVED
CHNIQTHTNYLDMLEEVNSGVAATAPGQLSPVSTAGIITPPKSTEKK
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgtcaagacgcagcagccgactgcaggccaagcagcagcagcagccaccgctgtcgtgt
caagaagagactccacgtgatctgcaggcaccagaacatctccagagcaggaaaaggaga
acggcagagcaggagtttaagaagaaagaagatgggaaagttgctaaaaaacatcaatat
gaaattaagagttgttggccgcccgcgataacaggaggcatctcgccttgcatcatcatt
gaaacgcctcacaaagaatcggtaaccactgacttctcaaggttcaaaaaatacaggttc
agaaacctcttcataaatccatcacctttgcctgaactcacctgggggaattccaaagat
gtgtggctcaacatcctgaagaaggagaaccgatacgctcactgcaaacacttcacttcg
ctacactcaagtttgcagccacacatgaggtcgatactgttggactggcttctagaggta
tgtgaggtgtatgcactccacagagaaaccttctacctagctcaagacttctttgataga
ttcatgttgacacagaagaacattaacaagagcatgcttcagctgataggaattacctca
ttgttcattgcctccaaacttgaggaaatctacgctccaaaaatacaggaatttgcttat
gtcactgatggtgcttgcagtgaagatgatattgtgagaatggaacttattatgttaaag
gctttaaaatgggaactgtgtcctgtgacaatcatctcttggctgaacctctatcttcaa
gtggatgctctgaaggacgttccaaaagtgcttctacctcagtattctcaggaaaaattc
attcagatagctcagctcttagacctgtgtattttggatgtgaattctttagacttccag
tacagaacactagctgctgctgcactctgccactatacctcaactgaagtagttaagaaa
gcttcaggcttagattgggacagcatttcagaatgtgtagagtggatggttccatttgtg
aacgtggcgaggaaagtctctgtgaaactgaagcatttcaagaaggttgcagtagaagac
tgccacaatatccaaacacacacaaactacttggacatgctggaagaagttaatagtgga
gtagcagctactgccccaggtcagttatcacctgtgtcaacagcaggaataataactcct
cccaaaagtacagagaagaaatga

KEGG   Meleagris gallopavo (turkey): 104913010
Entry
104913010         CDS       T01523                                 

Definition
(RefSeq) G1/S-specific cyclin-E1-like
  KO
K06626  G1/S-specific cyclin-E1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04110  Cell cycle
mgp04114  Oocyte meiosis
mgp04115  p53 signaling pathway
mgp04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104913010
   04114 Oocyte meiosis
    104913010
   04115 p53 signaling pathway
    104913010
   04218 Cellular senescence
    104913010
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mgp03032]
    104913010
   03036 Chromosome and associated proteins [BR:mgp03036]
    104913010
DNA replication proteins [BR:mgp03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    104913010
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    104913010
SSDB
Motif
Pfam: Cyclin_C
Other DBs
NCBI-GeneID: 104913010
NCBI-ProteinID: XP_010716275
LinkDB
Position
13
AA seq 256 aa
MAEGTGIVQSGEEEGQGRPLYSALKGGGSELVVSLFSQEYMIVDRPKRLTHAFLNLRPKG
CIVSVKNSLLILKCCVCLLFQALNWNLNPLTVVSWLNIYMQVAYLNELYEVLLPQYPQQI
FVQIAELLDLCVLDIGCLEYTYGVLAASALYHFSSSELMQKVSGYEWCEIEECVKWMVPF
AMAIREVGSSKLKHFRGIAPEDLHNIQTHINSLDLLDKAQAKQAILAEQNRTSPFPTGVL
TPPQSSKKQPAGLKPI
NT seq 771 nt   +upstreamnt  +downstreamnt
atggctgagggaactgggattgttcagtctggagaagaggagggtcagggaagacctctc
tacagtgccctgaaaggaggtggtagtgagctggtggttagcctcttctcccaggaatat
atgattgtcgatcgacccaaacgcctcacacatgcgtttttgaacctgaggcctaagggc
tgcatagtctcagttaagaattctttattaatactcaagtgctgtgtatgtctactcttt
caggctcttaattggaacttaaatccactgacagttgtatcatggctaaacatttacatg
caagttgcctatttaaatgagctttacgaggtattgttgccacaatatccacaacaaata
tttgtacaaatagcagagctcttggatctctgtgtgctggatattggctgcttggagtat
acatatggtgtacttgcagcttctgctttgtaccacttctcctcatctgagttgatgcag
aaagtttcaggttatgaatggtgtgagatagaggaatgtgtaaaatggatggttccattt
gctatggctataagggaagtaggaagctccaaactcaaacactttagaggtatagctcct
gaagacttgcacaatatacagacgcacataaacagcttggatttgctggacaaagctcaa
gcaaaacaagccatattggctgagcaaaataggacttcacctttccccactggtgtcctt
acaccaccacaaagcagtaagaagcagcccgctggactgaagccgatatga

DBGET integrated database retrieval system