KEGG   Meleagris gallopavo (turkey): 100545881
Entry
100545881         CDS       T01523                                 

Gene name
CD82
Definition
(RefSeq) CD82 antigen
  KO
K06509  CD82 antigen
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100545881 (CD82)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mgp04147]
    100545881 (CD82)
   04090 CD molecules [BR:mgp04090]
    100545881 (CD82)
Exosome [BR:mgp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100545881 (CD82)
  Exosomal proteins of other body fluids (saliva and urine)
   100545881 (CD82)
  Exosomal proteins of colorectal cancer cells
   100545881 (CD82)
CD molecules [BR:mgp04090]
 Proteins
  100545881 (CD82)
SSDB
Motif
Pfam: Tetraspanin Cas_Csx8 DUF2981
Other DBs
NCBI-GeneID: 100545881
NCBI-ProteinID: XP_003206446
Ensembl: ENSMGAG00000010519
LinkDB
Position
5
AA seq 265 aa
MGSGCLKVTKYFLFLFNLLFLILGAVILGFGIWILADKTSFISVLQTSSPSVRTGAYILV
GVGSLTMLMGFLGCLGAVNEIRCLLGLYFTCLMVILITQVAAGLVIYFQQEELKGELSRI
VEKLIEDYDPVNGEDKNLQDAWDYVQKQLTCCGWNGAEEWEKNNILINRSLTAYPCSCSN
SSKDAEENTGFCSLDVGVNGTATYADWPVHKQGCVDGVQDWLKDNLGIILGVCTGVAVVE
LLGMILSISLCKNIHSEDYTKVPKS
NT seq 798 nt   +upstreamnt  +downstreamnt
atggggtccggctgcttgaaagtcaccaagtacttcctgttcctcttcaatctcctgttc
cttattctgggtgctgtgatcctgggttttggaatatggattttggctgacaaaaccagc
ttcatttcagttctgcagacgtcatctccctctgtgaggactggcgcatacatcctggtc
ggtgttgggtctctcaccatgctgatgggattcctgggctgtcttggagcagtcaatgaa
atccgatgtctcttgggtctgtactttacctgcctcatggtgattctcataactcaggtg
gctgcaggactggtcatctatttccagcaagaagaactgaaaggagagttgtcacgcata
gttgaaaaactgattgaagattatgaccctgtgaatggtgaagataagaacttacaagat
gcgtgggactacgtgcagaaacagcttacctgctgtggctggaatggagcagaggagtgg
gaaaaaaataacattcttatcaacagaagcttgactgcgtatccctgctcctgctccaat
agttccaaggatgctgaggaaaatacaggcttctgtagtctggatgtcggggtgaatggt
actgcaacatatgctgactggcctgttcacaagcagggttgtgtggatggagtacaggat
tggttgaaggacaaccttggtatcattcttggagtctgcacaggtgttgctgttgtagag
ttgctggggatgatactctccatttcactctgcaagaacatacacagtgaagactacacc
aaagtgcccaagtcttga

DBGET integrated database retrieval system