KEGG   Meleagris gallopavo (turkey): 100546092
Entry
100546092         CDS       T01523                                 

Gene name
PIDD1
Definition
(RefSeq) p53-induced death domain-containing protein 1 isoform X1
  KO
K10130  leucine-rich repeats and death domain-containing protein
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
mgp04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100546092 (PIDD1)
   04115 p53 signaling pathway
    100546092 (PIDD1)
SSDB
Motif
Pfam: LRR_8 ZU5 Peptidase_S68 LRR_4 Death
Other DBs
NCBI-GeneID: 100546092
NCBI-ProteinID: XP_019470975
Ensembl: ENSMGAG00000009084
LinkDB
Position
5
AA seq 931 aa
MHICSLSEPSFLFFPIPAACRCLPAWQVRACLVPLDKTQKMAELLKLVEEHEEGAPGAPS
LTDSCLADNRLTLDVYPDGCCRLLRLFKRQPAEVVQVELLRLSSNDHLLDAALIILPYLK
RLKSLVLKGGHVRDEFGSCQHGSLTSLPPDIGTLRFLTHLDLSFNSLSTLPSCIPCLTSL
RMLLVSHNNLVALPENFGSLSKLTFFSAMKNQLKDLPQSIGELAALEELDLSENVLEHLP
EEVGNLHSCTELDLSGNQLSSIPDCLGNLKSLRRLHLHSNLLVTVPASLASLPNLSRLDL
QSNLLRAVPPEIQTAPFVHLRGNPLGETELSLQADESSATELRRLFLAPEEDSFTVTSEG
CEVFLACGIRFYFPPEAASDSLRIHFRTLAPDPRWVKLRHHDVLLSKVLELQPHGVKFQQ
EVEIWMPYASPETLHKREVVVRTFSGQSWSDLRTQVEKRRSKKDVARCSVLHFSWFLVVS
RLVQNECKVSTEGTLLFSSVDPNIKVTFPPGVTEETRSVKLQVLPVSAEEIAELTADAEC
KASPLLCLSQDSLVDFLTPVRIQLPLPLGVTGSNLDWSRLHLLCGDVEGQTWDDITNEVM
LELTHLCAVFEVTHFSWYWLWYTTKTYIGGIARKVYERLRMYQVNFIALQRKKDPEQVLL
QCLPKHKVDPVLKKLQDRYRGPEPSDMVEMFEGEQFFAAFERGISIDMDRPDCVDGRLSF
IFYSHLKNMKEIYVTSPVDRKGQAVKGQVSFYRGAVPESIPEDASRRRRGPDSLWLATLP
IKLPRLKPRWGETSSSSNGFSFPPLNLGNAETGYLTQANLLSIARRVGADWQTIGLNLGL
TYQQIERIGYNNREDLDKQILDMLFSWAQQNSEDPDCVSKLIRAMKESGRQDIADEVETI
IELGRQKYRESIRRVGLEQESSTEDSAIAMT
NT seq 2796 nt   +upstreamnt  +downstreamnt
atgcatatctgttctctttcagagccatcctttctcttcttccccatcccggcagcctgc
cgttgcctgcccgcctggcaggtcagagcatgtctggtccccttggacaagacgcagaag
atggcagagctgctgaagcttgtggaagagcatgaggagggggctccgggggctccttcg
ctcactgactcctgcttggcagacaacaggctcactctggatgtttatcccgatggctgt
tgtcggctgctccggctgttcaagaggcaaccggcagaggtggtgcaggtggagctcctc
cggctcagcagtaacgatcacttgcttgacgctgcgctgatcatccttccgtatctgaag
cgcttgaagtccctggtgctcaaaggtggccatgtcagagatgaatttggttcatgtcag
cacggttccctgacaagcttgccaccagatattgggaccctgagatttctcactcacttg
gatctcagcttcaatagtctctccaccttgcccagctgcatcccttgcctcaccagcctc
cgcatgctcttggtgagccacaacaacttggtggctcttcctgagaactttggctcactg
agcaagctgactttcttctctgctatgaaaaatcagctgaaggacttacctcagagcatt
ggggagctggcagcattggaggaactggatctctcagaaaatgtgttggaacatctccct
gaagaggttggaaatctgcacagctgcacagaactggatctctctgggaatcagctatca
agcatcccagattgtttaggcaatttgaagtctctgcggcggctacatcttcacagcaat
cttctggtgacagtccctgcatcgctcgccagcctgcccaatttgtccaggcttgatctg
cagagcaacctcctccgtgctgtcccccctgagatacagactgcaccatttgtgcacctc
cgaggcaaccctttaggagaaactgagctgtccctgcaggctgatgaatccagtgccaca
gagctacgaagactgttccttgcaccagaagaggatagtttcacagtgacctctgaaggt
tgtgaagtgttcctggcctgtggcatccgtttctactttccaccagaggctgcctctgac
tctctgcggatccacttccgaaccttggcaccagaccctcggtgggtgaagctgagacac
catgatgtcctgctgagcaaagtcctggagttgcagcctcatggggtcaaattccagcag
gaggtagagatctggatgccatatgcctctccagaaactcttcacaagcgtgaggtggtt
gttcggacctttagtgggcagagctggagtgacctgagaacacaagtggagaagagaagg
tcaaagaaggacgtggctcgctgtagtgttcttcacttctcctggttccttgttgtgtct
cgacttgtgcaaaatgaatgcaaagtgtcaacagaggggacattactcttttccagtgtg
gatccaaacatcaaagtgaccttccctcctggagtcactgaagagactcgcagtgtcaaa
ctgcaggttctgccagtctctgcagaagagatagcggaactcacagctgatgcagaatgc
aaagccagtcctctgctctgcctctcccaggattccctggtagatttcctcacgcctgtg
agaattcagctcccgctcccacttggggtcacagggtcaaacttggattggtcaaggctg
catcttctttgtggggatgtggagggccaaacttgggatgatatcaccaatgaagtgatg
ctggaactcactcatctctgtgcagtatttgaagtcacccacttctcctggtactggctg
tggtacaccaccaagacctacattggaggcattgccaggaaagtttatgagcggttacgt
atgtaccaggtgaacttcattgctctgcagaggaagaaggaccccgagcaagtcctgcta
cagtgtctccccaagcacaaggttgacccagtgctgaagaagctgcaggaccgctaccga
ggacctgagccatctgacatggtggaaatgtttgaaggagagcagttctttgcagctttt
gagagaggcatcagcatcgatatggatcgccctgactgtgtggatggacgtctgtcattt
attttttattcccacttgaagaacatgaaggaaatctacgtgacttcccctgtagacaga
aaaggccaagctgtaaaaggccaggtctctttctaccgaggggcagttcctgagagcatt
cctgaagatgccagcaggaggagaagaggaccagactctctctggctcgctactttacca
atcaaactgcctagattgaaaccccgttggggtgagacctccagttcatcaaatggcttc
tcctttcctcccttgaacctgggcaatgctgagactggctacctgacacaggcaaacctg
ctgagcatcgccaggcgtgtgggagctgactggcagaccattggcctgaacctgggcttg
acctatcaacagattgagcgcataggatacaataacagagaggaccttgataagcaaatc
ctggacatgcttttctcatgggcccagcaaaactcagaggatcctgactgtgtgagcaag
ctgatcagggccatgaaagagagtggccgccaggacattgctgatgaggtcgaaaccatc
attgagctgggacggcagaaatacagggagtccatccgccgtgtgggcttggagcaggag
agcagcactgaagactctgcgatagccatgacatag

DBGET integrated database retrieval system