KEGG   Meleagris gallopavo (turkey): 100546162Help
Entry
100546162         CDS       T01523                                 

Gene name
NOTCH1
Definition
(RefSeq) notch 1
  KO
K02599  Notch 1
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100546162 (NOTCH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_CA EGF_2 Notch Ank_2 Ank DUF3454 NOD NODP Ank_5 Ank_3 Ank_4 cEGF EGF_3
Motif
Other DBs
NCBI-GeneID: 100546162
NCBI-ProteinID: XP_019476850
LinkDB All DBs
Position
19
AA seq 2679 aa AA seqDB search
MEVCTELSRTALEPRLRPHRSVRSRFVAVVGGVSRVPLAPLLNNPPPLRLPDIGPGADPC
AEPQRAELPSGAEGGWGVGSGAAPTGRAELEPLETLFVGQSEAHSPLRPPGLTGSLRCCR
GEVRFGLRLCDAAFAQSVPDAVLLFTGVRCTQLAESCLNGGKCETFLNGTEVCHCSSAHV
GERCQLPNPCLSSPCKNAGTCIPLVRGSTADYSCVCRLGFTDELCLTPLDNACLNNPCRN
GGTCDLVTLSEYKCRCPPGWSGKTCQQADPCASNPCANGGQCVPFEVHYICSCTAGFHGA
NCKQDVNECNISPPVCKNGGSCTNEVGTYQCSCKPAYTGQNCEHLYVPCNPSPCQNGGTC
RQTGDTTYDCTCLPGFAGQNCEENIDDCPGNNCRNGGTCVDGVNTYNCQCPPEWTGQYCT
EDVDECQLMPNACQNGGTCHNNHGGYNCVCVNGWTGEDCSENIDDCAMAACFQGATCHDR
VASFYCECPHGRTGLLCHLDDACISNPCNEGSNCDTNPVNGKAICTCPSGYMGPACNQDV
DECSLGANPCEHAGKCINTQGSFQCQCLQGYSGPRCEIDVNECLSNPCQNDATCLDQIGE
FQCICMPGYEGVYCEINTDECASSPCLHNGNCLDKINEFHCECPTGFNGHLCQFDIDECA
STPCKNGAKCVDGPNTYSCECSEGFSGVHCEIDIDECNPDPCHYGTCKDSIAAFTCLCQP
GYTGHRCDININECQSQPCRNGGTCQDRNNAYNCLCLKGTTGPNCEINLDDCASNPCDYG
KCIDKINGYECTCEPGYTGRMCNINIDECASNPCHNGGTCKDGINGFTCLCPEGFHDPKC
LSEVNECNSNPCIHGRCHDGLNGYRCDCDPGWSGTNCDINNNECESNPCMNGGTCKDMTS
GYICTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYTCNCLLPYTGATCEDVLAPC
AGGPCKNGGECRESEDYKRFSCSCPPGWQGQTCEIDINECVKSPCRNGATCQNTNGSYRC
LCRVGFAGRNCDTDIDDCQPNPCHNGGSCSDGIGTFFCECLAGFRGLKCEEDINECASNP
CKNGANCTDCVNSYTCTCPSGFSGIHCENNTPDCTESSCFNGGTCVDGINTFTCLCPSGF
TGSYCEHNINECDSKPCLNGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGK
CWQTNNLYRCECNSGWTGLYCDVPSVSCEVAAKQQGIDVAHLCRNSGLCVDSGNTHFCRC
QAGYTGSYCEEQVDECSPNPCQNGATCTDYLGGYSCECVAGYHGVNCSEEINECLSHPCQ
NGGTCIDLINTYKCSCPRGTQGVHCEINVDDCSPFFDPVTLGPKCFNNGKCTDRVGGYSC
ICPPGFVGERCEGDVNECLSNPCDARGTQNCVQRVNDYKCECRPGYAGRRCDTVVDGCKG
KPCRNGGTCAVASNTGRGFICKCPPGFVGATCENDSHTCGTLHCLNGGTCISVHKSSKCV
CAAAFTGPECQYPASSPCISNPCYNGGTCEFLSDASPYYHCNCPANFNGLNCHILDFDFQ
GGFGQDIIPPKIEEKCEIAVCASYAGNKICDGKCNNHACGWDGGDCSLNFNDPWKNCSQS
LQCWKYFNDGKCDSQCNNAGCLYDGFDCQKYEGQCNPLYDQYCKDHFSDGHCDQGCNNFE
CEWDGLDCANNMPEKLADGTLVVVVLITPENLKNNSFNFLRELSRVLHTNVVFKKNAKGE
YMIFPYYGNEEELKKHYIKRSTEDWADMSSAVINKVKSSFYSRAGRRQKRELDQMDIRGS
IVYLEIDNRQCIQSSSQCFQSATDVAAFLGALASLGNLNIPYKIEAVKSETAEPARNSQL
YPMYVVVAALVLLAFIGVGVLVSRKRRREHGQLWFPEGFKVTESSKKKRREPLGEDSVGL
KPLKNASDGTLMDDNQNEWGDEETLDTKKFRFEEQAMLPDTDDQTDHRQWTQQHLDAADL
RISSMAPTPPQGEIDADCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEDDAPAVISDF
IYQGASLHNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADA
QGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINCHADVNAVDDLGKSALH
WAAAVNNVEAAVVLLKNGANKDMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHM
DRLPRDIAQERMHHDIVRLLDEYNLVRSPPLHSGPLGAPTLSPPLCSPSSYIGNLKPAVQ
GKKARKPSTKGLSCNGKDSKDLKARRKKSQDGKSCLLDNASVLSPVDSLESPHGYLSDVA
SPPLMTSPFQQSPSMPLNHLPGMPDAHMSINHLNMAGKQEMALGGSGRMAFEAVPPRLSH
LPVSSPSTAMSSAPMSFSVGGAAGLSGQCDWLSRLQGGMVQNQYSAMRGGMQPGTHQQAQ
NLQHGMMSSLHNGLPSTSLSQMMSYQAMPSTRLASQPHLLQNQQMQQMQQPGMQPQPGMQ
PQPGMQQPQQQQPQQQPQPQQHHNPGSNASGHMGQNFLGTELSQPDMQPVSSSAMAVHTI
LPQDSQLLPTSLPSSLAQPMTTTQFLTPPSQHSYSSPLDNTPSHQLQVPDHPFLTPSPES
PDQWSSSSPHSNVSDWSEGISSPPTSMQSQMGHIPEAFK
NT seq 8040 nt NT seq  +upstreamnt  +downstreamnt
atggaggtctgcacagagctatccagaaccgcactggagccgcggctacgaccgcaccgg
agcgtccggagccgctttgtggccgtggtggggggcgtcagccgggtgcccctcgccccc
ctcctgaacaacccccctcccctccgcctccccgacatcggccccggggcggatccgtgt
gcagagccgcaaagggcagagctgccgtcgggggccgaagggggatggggggtgggcagt
ggggccgccccgacgggccgggcagagctggagcctctcgagacgctgtttgtagggcag
agcgaggcccactccccgctccgtccgccggggctgacggggtcgctccgctgctgtcgg
ggggaggttcggttcgggctgcggctctgcgacgctgcgttcgctcagtctgtgcctgat
gctgtccttctgttcacaggtgtgcggtgcacgcagctggccgaatcctgcctcaacggg
ggcaagtgtgaaactttcctcaatgggacggaagtgtgccactgcagcagtgcccatgtg
ggcgagcggtgccagctgcccaacccctgcctcagctccccctgcaagaacgccggcacc
tgcatccccctggtgcgtggcagcaccgccgactacagctgcgtctgccgcctgggcttc
accgacgagctctgcctgacccctctggacaacgcctgtctcaacaacccctgccgcaac
gggggcacctgtgacctggtgacactcagcgagtacaagtgccgctgcccgccgggctgg
tcaggtaaaacctgccagcaggccgacccctgcgcctccaacccctgtgccaacgggggt
cagtgcgtcccctttgaagtccactacatctgcagctgcacggccggcttccacggggcc
aactgcaagcaggacgtgaacgaatgcaacatctcaccacctgtctgcaagaacggcggc
agctgcaccaacgaggtgggcacctaccagtgctcctgcaagccagcctacaccgggcag
aactgcgagcatctctatgtgccctgcaacccctcaccctgccagaacgggggcacgtgc
cgccagacgggggacaccacctacgactgcacctgtctgccagggttcgccgggcagaac
tgtgaggagaacatcgatgactgtccagggaacaactgcaggaatgggggcacctgcgtg
gatggcgtcaacacctataactgccagtgcccgcctgagtggacaggtcagtactgcacc
gaggatgtggatgagtgccagctgatgcccaatgcctgccagaacgggggcacctgccac
aacaaccacggtggctacaactgtgtctgtgtcaatggctggacgggcgaggactgcagt
gagaacatcgatgactgcgccatggccgcctgcttccagggggccacctgccacgaccgg
gtggcctccttctactgcgagtgtccccatgggcgcacaggtttgctgtgccacctggat
gacgcctgcatcagcaacccctgcaacgagggctccaactgtgataccaaccctgtcaat
ggcaaagccatctgcacgtgtccttcggggtacatggggccagcgtgcaaccaggacgtg
gatgagtgctcactgggagccaacccctgtgagcacgcggggaagtgcatcaacacccag
gggtccttccagtgccagtgtctgcagggctactcaggcccccgctgtgagatcgatgtc
aatgagtgtctctccaacccctgccagaacgatgccacctgcctggaccagatcggggag
ttccagtgcatctgcatgcctggatacgagggcgtctactgtgaaatcaacacagacgag
tgcgccagcagcccctgcctgcacaatggcaactgcctggataagatcaacgagttccac
tgcgagtgtcccaccgggttcaacgggcacctgtgccagttcgacatcgatgagtgcgcc
agcaccccctgcaagaatggggccaagtgcgtggatggccccaatacctacagctgcgag
tgctccgaaggtttctcgggtgtacactgtgagatcgacattgatgagtgcaaccccgac
ccgtgccactatgggacctgcaaggacagcatcgccgccttcacctgcctctgccagccc
ggctacacgggccaccgctgcgacatcaacatcaatgagtgccagagccagccctgcaga
aacggggggacctgccaggacaggaacaacgcctacaactgcctgtgcctcaaggggacc
acggggcccaactgcgagatcaacctggacgactgcgccagcaacccctgtgactacggc
aagtgcatcgacaagatcaatggctacgagtgcacctgtgagccggggtacacagggcgc
atgtgcaacatcaacatcgatgagtgtgccagcaacccgtgccacaatgggggcacatgc
aaggacggcatcaatggcttcacctgcctctgccccgagggcttccatgaccccaagtgc
ctgtccgaagtgaatgagtgcaacagcaacccctgcatccacgggaggtgccacgatggg
ctgaacggttaccgctgtgattgcgacccgggctggagcgggacaaactgtgacatcaac
aataatgagtgtgaatccaatccctgcatgaatggtggcacctgcaaggacatgaccagc
ggttacatctgcacctgcagggaagggttcagtggacccaactgccagaccaatatcaat
gaatgcgcttccaacccctgcctgaaccaaggcacgtgcattgacgacgtggctggctac
acctgcaactgtctcctgccctacacaggagccacctgtgaggacgtgctggccccctgc
gccggcggcccctgcaagaacggcggcgagtgccgggagtcggaggactacaagaggttc
tcgtgcagctgcccacccggctggcaaggccagacgtgcgagattgacatcaatgagtgt
gtgaagagcccctgccgcaatggggccacgtgccagaacaccaacgggagctaccgctgc
ctgtgccgggtgggcttcgcaggccgcaactgtgacaccgacatcgatgactgccagccc
aatccatgccacaacggtggctcctgctcggatggcattggcacgttcttctgtgagtgc
ctggccggcttccgcgggctcaagtgcgaggaggacatcaatgagtgtgccagcaacccc
tgcaagaacggggccaactgcaccgactgcgtcaacagctacacctgcacctgcccctcc
ggcttcagcggcatccactgcgagaacaacacgcctgactgcactgagagctcctgcttc
aatggggggacctgcgtggatggcatcaacaccttcacctgtctctgtccatccggcttc
acgggcagctactgtgagcacaacatcaacgagtgtgactccaagccctgcctcaatggg
ggcacgtgtcaggacagctacgggacgtacaagtgcacctgtcctcagggatacacgggg
ctcaactgccagaacttggtgcgctggtgtgactcctcaccctgcaaaaatgggggcaag
tgctggcagaccaacaacctgtaccgctgcgagtgcaacagcggctggacggggctctac
tgtgatgttcccagcgtctcctgcgaggtggctgcaaagcagcaaggtatcgacgtcgct
catctctgcaggaactcggggctctgtgtggacagtggcaacactcacttctgccgctgc
caggccggctacaccggcagctactgcgaggagcaagtggacgagtgctccccaaacccc
tgccagaacggagccacctgcacggactacctggggggctattcctgtgagtgcgtggct
ggttatcatggagttaactgctcagaggagatcaatgagtgcttgtcccacccatgccag
aatggaggaacctgtatcgatctcatcaatacctacaaatgctcctgccccagaggaact
caaggggtgcactgtgagatcaatgtggatgactgcagccctttctttgatcctgtcacc
ttggggcccaagtgctttaacaatggcaagtgcacggatcgggtaggtggctacagctgc
atctgcccccctggctttgtaggggagcgctgcgagggagacgtcaacgagtgcctctcc
aacccctgcgacgcgcgcggcacccagaactgcgtgcagcgggtcaatgactacaaatgc
gagtgccggcccggctacgcagggcgtcgctgtgacactgtggtggatggctgcaagggc
aaaccctgcaggaatgggggaacgtgtgctgtggccagcaacaccggccgtggctttatc
tgcaagtgccctccgggctttgtgggtgccacctgcgagaacgactcccacacctgtggg
accctgcactgcctgaatggtggcacctgcatctccgtgcacaagagctccaagtgcgtg
tgtgcggcggccttcacgggcccggagtgccaatacccggccagcagcccctgcatctcc
aacccctgctacaacgggggcacctgcgagttcctcagcgacgcctccccttactaccac
tgcaactgccccgccaacttcaacggcctcaactgccacatcctcgactttgatttccaa
ggcggcttcgggcaggacatcatcccacccaaaattgaggagaagtgtgagatcgccgtt
tgcgcgagctatgccggcaataagatctgtgatgggaagtgcaacaaccacgcctgcggc
tgggatggcggtgactgctcgctcaatttcaatgacccctggaagaactgctcacagtca
ctgcagtgctggaagtacttcaatgatggcaagtgtgactcgcagtgcaacaacgcgggc
tgcctgtatgatgggtttgactgccagaagtacgaggggcagtgcaaccccctgtatgac
cagtactgtaaggaccacttctcagatggtcactgtgaccagggctgcaataactttgag
tgtgagtgggacgggctggactgtgcaaacaacatgcctgagaagctggcggatggcacg
ctggtggtggtggtcctcatcacccctgagaacctgaagaacaattccttcaacttcctg
agggagctgagccgcgtgctgcacaccaatgtagtctttaagaagaacgccaagggagag
tacatgatcttcccatactacggcaatgaggaggagctgaaaaagcactacatcaagagg
tcaacggaggactgggcagatatgtccagtgctgtcatcaacaaagtgaagagcagcttc
tactcgagggctggcaggaggcagaagagagagctggatcagatggacatcagaggatcc
atcgtctacttggaaattgacaaccggcagtgcatccagtcgtcctcccagtgcttccag
agtgcaaccgatgtggcagccttcctgggggccttggcctccctgggcaacctgaacatc
ccctacaaaatagaggccgtcaagagtgaaacggcggagcccgcgaggaactcccagctg
tatcctatgtatgtggtggtggctgcactggtcttgcttgctttcattggagtgggagtg
ctggtgtcccgcaagcggcgcagggagcatggccagctctggttcccagagggcttcaaa
gtgacggagtcgagcaagaagaagcgccgagaaccgcttggggaagattctgttggactg
aaacccctcaaaaatgcctctgacggcacgctgatggacgacaaccaaaatgagtggggt
gacgaggagaccctggacaccaagaagttcaggttcgaggagcaagcgatgctgcctgat
acagatgaccagacagaccacaggcagtggacccagcagcacctggatgctgccgacctc
cgcatctcctccatggccccaaccccaccgcagggcgagatcgatgcagactgcatggat
gtcaacgtacggggtccagatggtttcacgcccctcatgatcgcctcgtgcagcggagga
gggctggagactggtaacagcgaggaggaggacgatgctcctgcagtcatctcagatttc
atctaccagggcgccagtttgcacaaccagaccgaccgcactggcgagacggcgctgcac
ctggctgcccgctactcgcgctccgacgctgccaaacgcctgctggaggccagtgctgat
gcaaacattcaggataacatgggcaggacccctctgcacgccgccgtctctgccgatgcc
caaggagtcttccagatcctgataaggaacagggcgactgatcttgatgcccgaatgcac
gacgggacgaccccactgatcctggctgctcgcttggctgtggaaggaatgctggaggac
ctcatcaattgccacgcagatgtcaacgctgtggatgatctgggcaagtcagcactgcac
tgggcagctgctgtgaacaatgtcgaagccgcagtcgtcctcttgaagaacggtgccaat
aaggatatgcagaacaataaggaggagaccccactgttcctcgccgccagagaagggagc
tacgaaacagccaaggtcctgctggaccactttgcgaaccgcgacatcacggaccacatg
gaccggctgccgcgggacatcgcgcaggagcgcatgcaccacgacatcgtgcgcctgctg
gatgagtacaacctggtgcggagccccccgctgcacagcggccccctcggggcccccacg
ttgtcccccccgctctgctcccccagcagttacatcggcaacctgaagcccgccgtgcag
ggcaagaaagccaggaagccgagcaccaagggcctgagctgcaacggcaaggattccaaa
gacctgaaagctcggaggaaaaaatcacaagatggaaaaagctgtctgctcgacaacgcc
agcgtgctgtccccagtggactccttggagtcaccccatgggtacctgtccgacgtcgcc
tcccctccactgatgacttctccgttccagcagtccccttccatgcctctgaaccacctg
ccgggcatgcccgacgcccacatgagcatcaaccacctcaacatggcagggaagcaggag
atggccctgggcggctctggcaggatggccttcgaggcggtgccgccgcgcctctcgcac
ctccccgtctccagccccagcacggccatgagcagcgccccgatgagtttctctgtcggc
ggagccgccggcctgagcgggcagtgcgactggctgagccggctgcagggcggcatggtg
cagaaccagtacagcgccatgcggggcggcatgcagccgggcacgcaccagcaggcacag
aacctgcagcacggcatgatgagctccctgcacaacgggctgcccagcaccagcctgtcg
cagatgatgagctaccaggccatgcccagcacccggctggcctcccagccccacctgctg
cagaaccagcagatgcagcagatgcagcagcccggcatgcagccgcagcccggcatgcag
ccgcagcccggcatgcagcagccccaacagcagcagccccagcagcagccccagccgcag
cagcaccacaaccccggctccaacgccagcggccacatgggccaaaatttcctcggtact
gagctgagccagcccgacatgcagccggtgagcagcagcgccatggcggtgcacaccatc
ctgccccaagattcacagctgctacccacctctctgccgtcctccctcgcgcagcccatg
accaccacgcagttcctgacccccccttcccagcacagctattcctccccgttggacaac
acccccagccaccagctccaggtgcccgaccaccccttcctcactccctctccggagtct
ccagaccagtggtcgagctcctcgccccactccaacgtgtccgactggtccgagggcatc
tccagcccccccaccagcatgcagtcgcagatgggacacatccccgaggccttcaagtga

DBGET integrated database retrieval system