KEGG   Meleagris gallopavo (turkey): 100546168Help
Entry
100546168         CDS       T01523                                 

Gene name
GCK
Definition
(RefSeq) glucokinase
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp00010  Glycolysis / Gluconeogenesis
mgp00052  Galactose metabolism
mgp00500  Starch and sucrose metabolism
mgp00520  Amino sugar and nucleotide sugar metabolism
mgp00524  Neomycin, kanamycin and gentamicin biosynthesis
mgp01100  Metabolic pathways
mgp01200  Carbon metabolism
mgp04910  Insulin signaling pathway
Module
mgp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mgp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100546168 (GCK)
   00052 Galactose metabolism
    100546168 (GCK)
   00500 Starch and sucrose metabolism
    100546168 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    100546168 (GCK)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100546168 (GCK)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100546168 (GCK)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     100546168 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 100546168
NCBI-ProteinID: XP_010725006
Ensembl: ENSMGAG00000016756 ENSMGAG00000017169
LinkDB All DBs
Position
Un
AA seq 465 aa AA seqDB search
MLDHRSRMESWRQEKVEQILSEFRLKEEDLRKVMHRMQKEMDRGLKLETHEEASVKMLPT
YVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWKVKTKHQMYSIPEDAMTGTAE
MLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNN
VVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDHRCEVGMIVGTGCNACYMEEMHN
VELVEGDEGRMCVNTEWGAFGASGELDEFLLEYDRVVDETSLNPGQQLYEKIIGGKYMGE
IVRLVLLRLVDENLLFSGQTCEKLKTRGAFETRFVSQVESDSGDRKQIYNILTAFGLLPS
GSDCDIVRMVCESVSTRAAQMCSAGLAGVINRMRESRSQETLKITVGVDGSVYKLHPSFK
DRFHATVRQLTPGCDITFIQSEEGSGRGAALISAVACKMACMMGQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgttggaccacaggagcaggatggagagctggcggcaggagaaggtggagcagatcctg
tcggagttccgtctgaaggaggaggacctgcggaaggtgatgcaccgcatgcagaaggag
atggaccgcgggctgaagctggagacgcacgaggaggcgtcggtcaaaatgctgcccacc
tacgtgcgctccacgccggaggggtcggaggtcggggatttcctctcgctggacctgggc
ggcaccaacttccgtgtgatgctggtgaaagtgggcgagggcgaggaggggcagtggaag
gtgaagacgaagcaccagatgtactccatccctgaggacgccatgacggggacggccgaa
atgctctttgactacatctcggagtgcatctctgacttcctggacaagcaccagatgaag
cacaaaaagctgcccctgggcttcaccttctccttccccgtgcggcacgaggacattgac
aagggcatcctgctgaactggaccaagggcttcaaggcctcaggagcggaggggaacaac
gtggtggggctgctgcgggacgccatcaaacggcgcggggactttgagatggacgtggtg
gccatggtgaacgacaccgttgccaccatgatctcctgctactacgaggaccaccgctgc
gaggtcggcatgatcgtggggacgggctgcaacgcctgctacatggaggagatgcacaac
gtggagctggtggagggcgacgagggccgcatgtgtgtgaacacagagtggggagcattt
ggggcatcaggggagctggacgagttcctgctggaatacgaccgcgtggtggacgagacc
tcgcttaaccccggtcagcagctctacgagaagatcatcgggggcaaatacatgggggag
atcgtgcggctggtgctgctgcggctggtggatgagaacctgctgttcagcgggcagacc
tgcgagaagctcaagacgcgcggagccttcgagacgcgcttcgtgtcgcaggtggagagc
gactcaggcgaccgcaagcagatctacaacatcctcacagcctttgggctgctgccctcg
gggtcggactgcgacatcgtgcgcatggtgtgcgagagcgtgtccacacgggctgcccag
atgtgctcagctgggctggccggcgtcatcaaccgcatgcgggagagccgcagccaggag
accctcaagatcaccgtgggggtggacggctctgtctacaaactgcaccccagcttcaag
gaccgtttccacgccaccgtacgacagctgactcccggctgcgacatcaccttcatccag
tcggaggagggcagcgggcgcggggctgcgctcatctcggccgtggcctgcaagatggcg
tgcatgatggggcagtga

DBGET integrated database retrieval system