KEGG   Meleagris gallopavo (turkey): 100546474
Entry
100546474         CDS       T01523                                 

Definition
(RefSeq) general transcription factor IIH subunit 2 isoform X1
  KO
K03142  transcription initiation factor TFIIH subunit 2
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03022  Basal transcription factors
mgp03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    100546474
  09124 Replication and repair
   03420 Nucleotide excision repair
    100546474
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mgp03021]
    100546474
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100546474
Transcription machinery [BR:mgp03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100546474
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     100546474
SSDB
Motif
Pfam: Ssl1 VWA_2 C1_4 VWA HscB_4_cys
Other DBs
NCBI-GeneID: 100546474
NCBI-ProteinID: XP_010724520
LinkDB
Position
Z
AA seq 395 aa
MDDEPERTKRWEGGYERTWEVLKEDESGSLKATIEDILFKAKRKRIYEHHGQVRLGMMRH
LYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQMGLIVTKNKRAEKMTEL
SGNPKKHIAALKKAVDMNCQGEPSLYNSLNLAMQTLKHMPGHTSREVLIVFSSLTTCDPA
NIYELIKCLKAVKIRVSVIGLSAEVRVCTVLTRETGGTYHVILDESHYKELLMHHVSPPP
ASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAQLENNSEPCLTLDGYFCPQCRAKYCE
LPVECKICGLTLVSAPHLARSYHHLFPLDAFQELPLEEYQGERCCQGCQAEIKDQNVYVC
KTCKNAFCVECDMFIHDSLHCCPGCIHEHPAPVSV
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggacgacgagcccgagaggactaagcgctgggaaggaggctacgagaggacgtgggaa
gtgctgaaggaagatgaatccgggtcgctgaaagcaaccatcgaggacatcctcttcaag
gcgaagaggaaaagaatctacgaacaccatggacaagtccggctgggaatgatgcgtcac
ctttatgtggttgttgatggatcaagaactatggaggaccaagatttaaaaccgaacaga
cttacttgcactttgaagctgctggaatattttgttgaagagtacttcgatcaaaatcct
attagtcagatgggcttaattgtaaccaagaataaaagagctgagaagatgacagagctt
tcaggtaacccaaaaaagcacatagctgctctgaagaaagcagtggatatgaactgccag
ggagagccatctctgtataattccctaaatttggccatgcagactttaaagcacatgcca
ggacacacaagcagagaggttttaatagtcttcagcagtcttacaacatgcgatccagcc
aacatctacgagctaatcaagtgtttgaaagcagttaagatcagagtgtctgtcattggt
ctaagtgctgaagttcgagtctgtacagtactgacccgagaaactggaggaacataccac
gttattttagatgaaagtcattataaggaactgctgatgcatcatgttagccctccacct
gccagttcaagttcggagtgctcccttattcgaatgggttttcctcagcacaccattgct
tccctttctgaccaagatgcaaagccatcctttagcatggcacaactggaaaacaacagt
gagccatgtcttacactggatgggtacttctgtcctcagtgcagagccaaatactgtgaa
cttcctgtggaatgcaagatctgtggtcttacactagtgtctgcacctcatctggctcgg
tcttaccaccacttgtttcctttggatgcctttcaggaacttccgctggaagaatatcag
ggagaacgatgttgtcaaggctgccaagcagaaatcaaagatcaaaatgtttatgtatgc
aaaacgtgcaagaatgcattttgtgtggaatgtgacatgtttattcatgattccctgcac
tgctgtcctggctgtattcacgagcaccctgctcccgtatcagtatga

DBGET integrated database retrieval system