KEGG   Meleagris gallopavo (turkey): 100546504Help
Entry
100546504         CDS       T01523                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100546504 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mgp03036]
    100546504 (HDAC4)
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100546504 (HDAC4)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100546504 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 100546504
NCBI-ProteinID: XP_010711503
Ensembl: ENSMGAG00000002138
LinkDB All DBs
Position
7
AA seq 1101 aa AA seqDB search
MHCAVPASRACCSCVLYAVMQKDGLSGREQPVELLNPPRVNHMPSSVDVSTALPLQVAPT
SVPMDLRLDHQFPMPVTEPTLREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHE
AQLHEHIKQQQEMLAMKHQQELLEHQRKLEQHRQEQELEKQHREQKLQQLKNKEKGKESA
VASTEVKMKLQEFVLNKKKALAHRNLNHCISSDPRFWYGKTQHSSLDQSSPPQSGVSGTY
NHPVLGMYDSKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPL
DVTDSACNSAPGSGPSSPNNSSNNISAENGITGSVTSIQAETSLAHRLVNREGSVTQLPL
YTSPSLPNITLGLPATGPSSGGSAQQDAERLAIPALQQRISLFPGTHLTPYLSTTTLERD
GGTAHNPLLQHMVLLEQPTAQTPLVTDWYLSGLPLHAQSLVGGERISPSIHKLRQHRPLG
RTQSAPLPQNAQALQQLVIQQQHQQFLEKHKQQFQQQQLHINKIISKPNEPARQHESHPE
ETEEELREHQALLEEPYSDRVSSQKEVPGLASMVQVKQEPIESDEEEAEPQQELESGQRQ
AEQELLFRQQALLLEQQRIHQLRNYQASLEAAGMPVSFGGHRPLSRAQSSPASATFPMSV
QEPPTKPRFTTGLVYDTLMLKHQCTCGNTNSHPEHAGRIQSIWSRLQETGLRGKCECIRG
RKATLEELQTVHSEAHTLLYGTNPLNRQKLDSKKLLGSLTSMFVRLPCGGVGVDSDTIWN
EVHSSGAARLAVGCVIELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAK
LLQQRLNVSKILIVDWDVHHGNGTQQAFYNDPNVLYISLHRYDDGNFFPGSGAPDEVGTG
AGVGFNVNMAFTGGLDPPMGDTEYLTAFRTVVMPIANEFAPDVVLVSSGFDAVEGHPTPL
GGYNLSAKCFGYLTKQLMGLAGGRVVLALEGGHDLTAICDASEACVSALLGNELDPLPEK
VLQQRANANAVHSMEKVIEIHSKYWHSLQRYASTVGYSLVEAQKCENEEAETVTAMASLS
VGVKPAEKRPDDEPMEEEPPL
NT seq 3306 nt NT seq  +upstreamnt  +downstreamnt
atgcactgtgctgtgcctgcttccagagcatgttgtagctgtgtcctctatgcagtgatg
cagaaagatgggctttctggcagagaacagccagtagagctgttgaatccacctagagtg
aaccacatgcccagctctgttgatgtgagcacagcactgcccttgcaagttgccccaacc
tcagtcccgatggatctgcgcctggaccaccagttccccatgcctgtgacagagccaacg
ctccgtgagcagcagctgcagcaggagctcctggcgctgaagcagaagcagcagatccag
aggcagatcctcattgctgagttccagcggcagcatgagcagctctccaggcagcacgag
gcccagctgcatgagcacatcaagcagcagcaggagatgctggcaatgaagcatcagcag
gagcttctggagcaccagaggaagctggagcagcaccggcaggagcaggagctggagaag
cagcaccgggagcagaaacttcaacagctgaaaaacaaagagaaaggaaaggagagcgca
gtggcaagcacagaagtaaagatgaaattacaagaatttgttttaaataagaagaaggct
ttggcacaccggaatctcaaccactgcatttccagtgaccctcgcttctggtatgggaag
acacagcacagctccttggaccagagctccccacctcaaagtggcgtatctggcacctac
aatcaccctgtcctggggatgtacgattccaaagatgacttcccactcagaaaaacagca
tctgaacccaacctgaaattacgatccagactaaagcaaaaagttgctgaacgacggagc
agccccctgttgcgcaggaaggatggcccagtggtcactgctctgaagaagcgcccgctg
gatgtcacagactctgcatgcaacagtgctcctggatctggtcccagctctccaaacaac
agttccaataacatcagcgctgagaatggaattacaggatcggtcacgagtattcaggcg
gagaccagcctggctcaccgactggtgaatcgtgaaggctctgtaacacagcttccactc
tacacttctccttctttgcccaacatcacactaggactgcctgcaactggcccttccagc
ggaggatcagcacagcaggatgctgagagacttgctatcccagccttgcagcagcggatc
tctttatttcctggcacccacctcactccctacttgagcactacaacgttggaaagagat
gggggaaccgcacacaaccctcttctgcagcacatggtcttactggaacagccaactgca
caaactcccttagtcacagactggtatctttcaggactgcccctccacgcacagtctctg
gttggtggagaacggatctccccttcaatacacaaactccggcagcatcgcccactgggg
cgcacgcagtctgctccccttccacagaacgcccaagccctccagcagttagtgatccag
cagcagcaccagcagttcttggagaaacacaaacagcaattccaacaacaacaactgcat
atcaacaagataatatcaaaacccaacgagccagctcgccagcatgaaagccacccagag
gagacagaagaagagcttcgagaacaccaagcccttttggaggagccatacagtgacaga
gtgtcaagccaaaaggaggtcccagggctggccagtatggtgcaggtgaagcaagaaccc
atcgagagtgatgaggaggaagctgagccgcagcaggagctggagtctgggcagaggcag
gctgagcaggagctcctcttccgccagcaagccctcctgttggagcagcagcgcattcac
cagctgagaaactaccaggcatcgctggaggcagctggcatgccagtctcctttgggggc
catcggcctctgtcccgtgcacagtcctcacctgcctcggccaccttccctatgtctgta
caggaaccacccactaagccaaggttcactacaggccttgtctatgacaccttgatgctg
aaacatcagtgtacctgtggaaacacaaacagccacccggagcatgcagggaggatccag
agcatctggtccaggctgcaggagacaggtctccgtggcaagtgcgagtgcattcgtgga
agaaaagcaactctagaagagctgcagacagttcactcagaagctcatacactgctgtac
ggcacaaaccctctgaacagacagaaactggacagcaagaaacttctaggttctctaacg
tcgatgtttgtcaggcttccttgcggtggtgtcggggtcgacagtgacacgatctggaat
gaagttcactcatctggtgctgctcgcctggctgtgggctgcgtcattgagcttgttttc
aaagtggccacaggagaactgaagaatggatttgctgttgttcgacctccaggtcaccat
gcagaagaaagcacacccatgggcttctgctatttcaactccgtggcaattgcagccaag
ctgctccagcagaggctgaatgttagcaaaatcctcatagtggactgggatgtgcaccat
gggaacggtactcagcaagctttctacaatgatcctaatgttctttatatttcactacat
cgctatgatgatgggaacttctttccaggcagtggtgctcctgatgaggttggcacagga
gcaggagttgggttcaatgttaacatggccttcactggaggccttgatccaccgatggga
gacacagaatacttaactgctttcaggacggtcgtaatgcccattgccaatgaatttgcc
ccagatgttgtgctggtgtcatctggttttgatgcggtagaaggccatcctacgcctctg
ggaggatataatctctctgcaaaatgctttgggtacctgacgaagcagctgatgggcctg
gccggaggccgcgtcgtcctggccctcgaaggaggccacgacctgactgccatttgcgat
gcctcagaagcatgtgtttctgctttgctgggaaacgagctcgaccctcttccagaaaaa
gttctccagcagagagcaaatgctaatgcggtgcattcaatggagaaagtgattgagata
cacagcaagtattggcattcactccagcgctatgcctccacagtgggctattccctggtt
gaggcacagaagtgtgagaacgaagaggctgagacagtgacagccatggcatctctgtca
gtaggcgtgaagccagctgagaagcgacccgatgatgaacctatggaagaggaacctccc
ctgtag

DBGET integrated database retrieval system