KEGG   Meleagris gallopavo (turkey): 100546510
Entry
100546510         CDS       T01523                                 

Gene name
CETN2
Definition
(RefSeq) centrin-2
  KO
K10840  centrin-2
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    100546510 (CETN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mgp03019]
    100546510 (CETN2)
   03036 Chromosome and associated proteins [BR:mgp03036]
    100546510 (CETN2)
   03400 DNA repair and recombination proteins [BR:mgp03400]
    100546510 (CETN2)
Messenger RNA biogenesis [BR:mgp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    TREX-2 complex
     100546510 (CETN2)
Chromosome and associated proteins [BR:mgp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    100546510 (CETN2)
   Centrosome duplication proteins
    Centriole replication proteins
     100546510 (CETN2)
DNA repair and recombination proteins [BR:mgp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      100546510 (CETN2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_9 EF-hand_5 EF-hand_4 EF-hand_14 SPARC_Ca_bdg SurA_N_3 Dockerin_1 SUB1_ProdP9 Asp-B-Hydro_N LETM1 RTP DUF853 DUF4601
Other DBs
NCBI-GeneID: 100546510
NCBI-ProteinID: XP_010713614
Ensembl: ENSMGAG00000005430
LinkDB
Position
9
AA seq 172 aa
MASSFKKPSLGAASQRKKSSPKPELTEEQKQEIREAFDLFDTDGTGNIDVKELKVAMRAL
GFEPKKEEIKKMISDIDKEGTGKISFNDFLAVMTQKMAEKDSKEEILKAFKLFDDDETGK
ISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVNEQEFLRIMKKTSLY
NT seq 519 nt   +upstreamnt  +downstreamnt
atggcctccagcttcaagaagccctcgctgggagcagcgtcccagaggaagaaatcgagt
cccaagccggagctgactgaagagcagaagcaggagatccgggaggccttcgacctgttt
gacacagacggcaccgggaacattgatgttaaggagctaaaggtggccatgagagcacta
gggtttgaacctaaaaaagaagaaatcaagaaaatgatatcagatatcgataaggaagga
acaggaaaaatcagtttcaatgacttcttggcagtgatgacccagaaaatggctgaaaaa
gattccaaagaggagattctcaaagcttttaagctcttcgatgatgatgaaactggcaaa
atctctttcaaaaacctcaaacgtgtagccaaagaactgggtgaaaatcttacagatgaa
gagctgcaggaaatgattgatgaagcagatagagatggcgatggggaagtgaatgagcag
gaattcttgcggatcatgaagaagaccagcctttactga

DBGET integrated database retrieval system