KEGG   Meleagris gallopavo (turkey): 100546549
Entry
100546549         CDS       T01523                                 

Gene name
SERPINB5
Definition
(RefSeq) serpin B5 isoform X2
  KO
K10139  serpin B5
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100546549 (SERPINB5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mgp01002]
    100546549 (SERPINB5)
Peptidases and inhibitors [BR:mgp01002]
 Peptidase inhibitors
  Family I4: serpin family
   100546549 (SERPINB5)
SSDB
Motif
Pfam: Serpin Toprim_Crpt
Other DBs
NCBI-GeneID: 100546549
NCBI-ProteinID: XP_010706719
Ensembl: ENSMGAG00000004714
LinkDB
Position
3
AA seq 377 aa
MTMDALQLANTAFAVDMFKKLCEKDKTANIVFAPLCTSTSLALAYKATKGDTADQMKKVL
HLQDVKDVSFGFQTVTADVSKLTSFFALKMVKRLFVDKSLSPTTDFVNSTKRPFPSELEL
VEFKEKTEETRQKINKSLSELTDGKMENILNEDSVSDQTQILLVNAAYFVTNWMKKFPEA
EIKECPFKVNKTETKPVQMMNLEATFCLGYVKELNVAILELPCLNKHISMLILLPKDIED
ETTGLEKLEKALTPETLLQWTNPSIMANTKVNVFLPKFSVEGDYDLKPLLESLGMTNVFD
ESASDFSEMCETKGVVLSKIIHKVSLEVNEQGGESLEVPGYRILQHKDEFKADHPFIFLF
RHNKTRNVILSGRFCSP
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgacaatggatgctctgcaactagcaaacactgcctttgctgttgatatgttcaaaaag
ctatgcgagaaggacaaaacagccaatattgtctttgccccactgtgtacctccacgtct
ttggctctggcatataaagctacaaagggtgacactgcagaccaaatgaaaaaggtgctc
catttacaagatgtcaaagatgtttcttttgggtttcaaacggtaactgcagatgtttcc
aaactcacctctttctttgcactgaaaatggtcaagcggctctttgtagacaaatctctc
agtcctaccacagattttgttaactccacaaagaggccttttccatcggagctggaacta
gtggagttcaaagaaaaaactgaggaaacacgacagaagatcaacaaatctctctcagag
ctaaccgatggcaaaatggagaatattttgaatgaggatagtgtaagtgaccagactcag
atcctcctagttaatgcagcttattttgtcacaaactggatgaagaagttcccagaggca
gagatcaaagaatgtccttttaaagtcaacaagactgaaactaagccagtgcaaatgatg
aatctggaagctacgttttgcctgggttatgtaaaagagttaaatgttgcaatccttgaa
cttccatgccttaacaaacatatcagcatgctcattctgctccccaaagacattgaagat
gagacgaccggcctggaaaagctggaaaaggcactcacccctgagacattgttacagtgg
accaatcccagcataatggccaacaccaaagtgaatgtatttcttccaaagtttagtgtg
gaaggtgattatgacctgaagccactcctggaaagcctcggcatgacaaatgtctttgat
gagagtgcatcagatttctctgaaatgtgtgaaaccaaaggtgtggttttgtcgaagatc
attcataaagtctctttggaagtaaacgaacagggtggagagtctctagaggtaccagga
tatcggattctgcaacacaaagatgaatttaaagctgaccatccgtttatctttttgttt
aggcacaacaaaactcgcaatgtgattctttcaggcagattctgttccccttaa

DBGET integrated database retrieval system