KEGG   Meleagris gallopavo (turkey): 100546827Help
Entry
100546827         CDS       T01523                                 

Gene name
TGM2
Definition
(RefSeq) transglutaminase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100546827 (TGM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 100546827
NCBI-ProteinID: XP_010720967
LinkDB All DBs
Position
22
AA seq 723 aa AA seqDB search
MGLQLRTRTLCCSRLRPNLPVSTGRCCRAEPHAVPFTELVLETCDLQCERNGREHRTAEM
GSQQLVVRRGQPFTITLNFTGRGYEEGVDKLAFNVETGPCPIETSGTRSHFTLTDCPEEG
TWNAVLQQQDGAVLCVSLCSPSNARVGRYRLTLEASTEYQGSSFHLGDFVLLFNAWHPED
AVYLQEEDERREYVLSQQGLIYMGSRDYMTSTPWNFGQFEDEILAICLEMLDINPKFLQD
QNLDCSHRNDPVYIGRVVSAMVNCNDEDHGVLLGRWDNHYEDGMSPMAWIGSVDILKRWR
RLGCQPVKYGQCWVFAAVACTVMRCLGVPCRVVTNYNSAHDTNGNLVIDRYLSEEGVEER
RSRDMIWNFHCWVECWMTRPDLAPGYDGWQALDPTPQEKSEGVYCCGPAPVKAIKEGDLQ
VQYDIPFVFAEVNADVVYWIVQSDGEQKKSTHSSMVGKNISTKSVGRDSREDITHTYKYP
EGSEKEREVFSKAEHEKSSLGEQDEGLHMRIKLSEGANNGSDFDVFAVISNDTDREHECR
LRLCARTASYNGEVGPQCGSKDLLNLTLQPRMAQSVPLRILYEQYGPNLTQDNMIKVVAL
LTEYESGDSVVAIRDVYIQNPEIKIRILGEPMQERKLVAEITLVNPLAEPLNNCTFVVEG
AGLTEGQRIEELEDPVEPQAEAKFRMEFVPRQAGLRKLMVDFESDKLTGVKGYRNVIIAP
LPK
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgggccttcagctccgcacccgcacgctgtgctgcagcagactgcgcccaaatctccct
gtgagcacggggagatgctgccgggcagagcctcacgcagtgcctttcacagagctggtg
ctggagacgtgcgacctgcagtgcgagcgcaatggccgcgagcaccggacggcggagatg
ggcagccagcagctggtggtgcggcgcgggcagcccttcaccatcaccctgaacttcacg
ggccggggctacgaggagggggtggacaaacttgccttcaacgtggagacggggccctgc
cccatcgagacgtcgggcaccaggtcacacttcaccttgactgactgccccgaggagggg
acctggaatgcagtgttgcagcagcaggacggggctgtgctctgtgtctctctctgctcc
cccagcaatgcccgtgtgggccgctaccgcctgacgctggaggcctccaccgagtaccag
ggctccagcttccacctcggggacttcgttctgctcttcaatgcctggcacccagaggat
gcagtgtacctgcaggaagaggacgagcgccgcgaatacgtgctgtcccagcaggggctc
atctacatgggctcccgggactacatgacctccacaccctggaactttgggcagtttgaa
gatgagatcttggccatctgcctcgagatgctggacatcaaccccaaattcctgcaggat
cagaacctggactgctctcatcgcaatgaccctgtttatattggcagggtggtgagcgcc
atggtcaactgcaacgacgaagaccacggggtgctgctggggcgctgggacaaccactat
gaggatgggatgagcccaatggcgtggatcggcagcgtggacatcctcaagaggtggagg
aggttgggctgccagcctgtcaagtacggccagtgctgggtcttcgctgccgtggcgtgc
accgtcatgcgctgcctgggtgtcccctgccgcgtggtcaccaactacaactctgcccac
gacaccaacggcaacctggtgatcgaccgctacctgagcgaggagggcgtggaggagcgg
cgctccagggacatgatctggaacttccactgctgggtggagtgctggatgacccggccc
gacttggcacctggatacgacgggtggcaagcgctggaccccacgccccaggagaagagt
gaaggggtttactgctgcgggccggcccccgtcaaggccatcaaggagggcgacctgcag
gtgcagtacgacatccccttcgtcttcgcggaggtcaatgccgacgtggtgtactggatc
gttcagagcgacggcgagcagaagaagagcacccactcctcaatggtggggaagaacatc
agcaccaagagcgtcggcagggacagccgcgaggacatcacccacacctacaagtatccc
gaggggtccgagaaggagcgagaggtgttcagcaaggcggagcacgagaagagctcgctg
ggtgagcaggacgaggggctgcacatgcggatcaagctgtcggagggtgccaacaacggc
tccgacttcgacgtcttcgctgtcatcagcaacgacacagacagggagcatgagtgcagg
ctgaggctgtgcgcccgcactgccagctacaacggcgaggtgggcccgcagtgcggctcc
aaggacctgctgaacctcaccctgcagccccgcatggcacagagcgtgcccttgcgcatc
ctctatgagcagtatgggcccaacctgacccaggacaacatgatcaaagtggtggctctg
ctgactgagtacgagagtggcgacagcgtggtggccatcagggatgtctacatccagaac
ccggagatcaagatcaggattttaggggagccgatgcaggagcggaagctggtggcagag
atcacactggtgaacccactggcagagccgctgaacaactgcacgttcgtggtggaaggc
gccggcctcactgaggggcagaggatcgaggagcttgaggaccctgtggagccgcaggca
gaggccaagttccggatggagttcgtgccgcgccaggcggggctgcgcaagctgatggtg
gactttgagagcgacaagctgacgggagtgaagggctaccgcaacgtcatcatcgcgccc
ctgcccaagtga

DBGET integrated database retrieval system