KEGG   Meleagris gallopavo (turkey): 100546861
Entry
100546861         CDS       T01523                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2 isoform X1
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04010  MAPK signaling pathway
mgp04060  Cytokine-cytokine receptor interaction
mgp04068  FoxO signaling pathway
mgp04144  Endocytosis
mgp04218  Cellular senescence
mgp04350  TGF-beta signaling pathway
mgp04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100546861 (TGFBR2)
   04350 TGF-beta signaling pathway
    100546861 (TGFBR2)
   04068 FoxO signaling pathway
    100546861 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100546861 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100546861 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    100546861 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100546861 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mgp01001]
    100546861 (TGFBR2)
Enzymes [BR:mgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100546861 (TGFBR2)
Protein kinases [BR:mgp01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   100546861 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH FixQ
Other DBs
NCBI-GeneID: 100546861
NCBI-ProteinID: XP_010711191
Ensembl: ENSMGAG00000011137
LinkDB
Position
6
AA seq 537 aa
MLEGYDTHRSKENGLQLPRLCKFCDIKATTCSNQYQCKSNCNITSICEKNNEVCAAVWRR
NDENVTLETICHDPQKRLYGHMLDDSSSEQCVMKEKKDDGGLMFMCSCTGEECNDVLIFS
ADDPHKPEEKDEISKVTIISLVPLLVISVAVIVIFYAYRTHKKRKLNKAWEKNVKPRKHK
DCSDVCAIMLDDDHSDISSTCANNINHNTELLPIELDIVVGKGRFAEVYKAKLKQNTSEQ
YETVAVKIFPYEEYASWKTEKDIFSDVNLKHENILQFLTAEERKTDLGKQYWLITAFHAR
GNLQEYLTRHIISWEDLWKLGGSLARGIAHLHSDHTPCGRPKTPIVHRDLKSSNILVKND
LTCCLCDFGLSLRLDPSLSVDDLANSGQVGTARYMAPEVLESRMNLENMESFKQTDVYSM
ALVLWEMTSRCNGVGEVKEYEPPFGSKVREHPCVESMKDNVLRDRGRPEIPSSWLNHQGI
QMVCETLIECWDHDPEARLTAQCVAERFSEFKHHDKLSGRSCSEEKIPEDGSVTTAK
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgctcgagggttatgatacacatagaagcaaggaaaatggactgcaattgcccaggctg
tgcaaattctgtgacattaaagcaacgacgtgctcaaaccagtatcagtgcaagagcaac
tgcaacatcacttctatctgtgagaagaataacgaagtctgtgcggctgtatggagacgg
aacgatgaaaatgtgacattagaaacaatctgccacgatccccagaaaagactgtatggt
cacatgttggatgactccagctcagagcagtgtgtgatgaaggagaagaaggatgatggg
ggactgatgttcatgtgctcctgtacaggtgaagagtgcaacgatgttcttattttttct
gcagatgatccccataagccagaggagaaagatgaaatttccaaagtcacaatcataagt
cttgtccccttgttggtgatttctgttgctgtgattgttatcttttatgcctaccgcact
cataagaagaggaagctcaacaaggcctgggagaagaatgttaagcccaggaaacataaa
gactgcagtgatgtttgtgccattatgttggatgatgatcactcagacatcagctctacc
tgtgccaacaacatcaaccacaacacagaattgctgcccattgagctggacattgttgtt
ggcaaaggaagatttgctgaagtgtataaagcaaaattgaagcaaaacacatctgagcag
tatgaaactgtggcagtaaagatcttcccctatgaagaatatgcctcctggaaaaccgag
aaagacattttttcggatgtaaaccttaagcatgagaacatcctccaattcttgactgca
gaggagcgtaagacagatcttggtaaacagtattggttgatcactgccttccatgctagg
ggaaacttgcaggaatacctcacacggcacattatcagctgggaagacctctggaaactg
ggaggatccttggcccgagggattgcccatctgcacagtgatcacacaccctgtggtcgt
cctaaaacccctattgtgcacagagacctaaagagttccaacatcctggtgaaaaatgat
ttaacttgctgtctctgtgactttgggttatccctcaggctggacccttctctctctgtg
gatgacttggccaacagcggtcaggttggcacagcaaggtacatggcccctgaggtcctg
gagtccaggatgaaccttgagaacatggagtcctttaaacaaacagatgtgtactccatg
gctttggtcctttgggaaatgacatctcgctgtaatggtgttggagaagtgaaagagtat
gagcctcccttcggctctaaagtgcgggaacatccctgcgtggaaagcatgaaggacaat
gtcctaagagacagagggcgacctgagatccccagctcctggcttaaccatcagggcatc
cagatggtgtgtgagacccttatcgagtgctgggaccacgaccccgaggctcggctcacg
gcgcagtgcgtggcggagcgcttcagtgagttcaagcaccacgacaagctctcagggaga
agctgttcagaggagaagatccccgaggacggctccgtgaccactgccaagtag

DBGET integrated database retrieval system