KEGG   Meleagris gallopavo (turkey): 100546889
Entry
100546889         CDS       T01523                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2 isoform X1
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
mgp  Meleagris gallopavo (turkey)
Pathway
mgp04068  FoxO signaling pathway
mgp04110  Cell cycle
mgp04115  p53 signaling pathway
mgp04120  Ubiquitin mediated proteolysis
mgp04144  Endocytosis
mgp04218  Cellular senescence
mgp04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mgp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100546889 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100546889 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100546889 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    100546889 (MDM2)
   04115 p53 signaling pathway
    100546889 (MDM2)
   04218 Cellular senescence
    100546889 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100546889 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mgp04131]
    100546889 (MDM2)
   04121 Ubiquitin system [BR:mgp04121]
    100546889 (MDM2)
Enzymes [BR:mgp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100546889 (MDM2)
Membrane trafficking [BR:mgp04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100546889 (MDM2)
Ubiquitin system [BR:mgp04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    100546889 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS DZR
Other DBs
NCBI-GeneID: 100546889
NCBI-ProteinID: XP_010706267
LinkDB
Position
1
AA seq 476 aa
MCNTEMTSLTDGSPVSASEQEALVKPKPLLLKLLKLAGAEKETFTMKEVIFYLGQYIMSK
QLYDEKEQHIVHCANDLLGDLFGVTSFSVKEHRRIYSMISRNLIAISQQDSTLAVPPEDD
AKFRLEKETVLKESMQEVEEKEASSNAISQPTTSSRRRTHSESEENSSDDLHSDRRKRHK
SDSISLTFDESLSWCVVSGLCRDRSNSSDSTDSVSIPDLDASSLSGSVSDQFSVEFEVES
IYSEDYSHNEEGQELTDEDDEVYQLTIYQDEDSDSDSFNEDPEISLADYWKCPECSEMNP
PLPRHCHRCWALREDWLPDEKSDKLVKSKLEGSFHLESDEGFDVPDCKKVKTNEDKEPAV
EENEDKAVQISESQESEDYSQPSTSSSVFCSSQEDFKEPEKKEMKDREEGMESSLPVSSI
EPCVICQSRPKNGCIVHGKTGHLMSCFTCARKLKKRNKPCPVCRQPIQMIVLTYFG
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgtgcaataccgagatgacctccctgacggacggctctcctgtcagcgcctcggagcag
gaggctctggttaaaccaaagccactgttgttgaagctgttgaagttagctggtgcagaa
aaagagacttttactatgaaggaggtaatattctatcttggacaatatattatgtctaaa
cagttatacgatgaaaaagagcaacatattgtgcactgtgcaaatgatcttcttggggat
ttatttggagtaacaagcttttcagtaaaagaacacaggagaatatattccatgatttcc
agaaatctgatagcaatcagtcaacaagattctacactggctgttccacctgaggacgat
gccaaatttcggcttgaaaaagaaactgtactaaaggaatccatgcaagaggtagaagag
aaggaggcttcatcaaatgcaatttcccagccaaccacatcttctaggaggagaacacac
agtgaatctgaagaaaattcttcagatgatctgcatagtgacagaagaaaacgtcataag
tcggacagcatctcgttgacctttgatgaaagtctctcatggtgtgtagtcagcgggctg
tgccgtgacagaagcaacagcagtgattctacagattctgtttccattcctgatcttgat
gccagttcgctaagtggttctgtttcagaccagtttagtgtagagtttgaagttgaatct
atttattcagaagactatagccataatgaagaaggacaggagctcacagatgaagatgat
gaggtgtatcagctgactatatatcaagatgaagatagtgattctgattcattcaatgaa
gatccagagatttctctagctgactattggaagtgccctgaatgtagtgaaatgaatcct
ccgcttccacgacattgccacagatgttgggccctccgcgaggactggcttcctgatgag
aagagcgataaattggtgaagagcaaattagaaggttctttccacctggaatctgacgaa
ggttttgatgttcctgactgtaagaaagtgaaaacgaatgaagataaagaacctgctgtg
gaggagaacgaagataaagcagtacagatatctgagtcccaggaaagcgaagattattct
cagccatctacgtctagcagcgtgttttgcagcagccaggaggacttcaaggaacctgag
aagaaagaaatgaaagacagagaggaaggtatggagtccagtctgcctgttagcagcata
gagccctgtgtcatatgccaaagcaggccaaaaaatggctgcatagtacatggcaaaaca
gggcatctcatgtcgtgttttacgtgtgcaagaaaactgaagaagaggaacaaaccctgc
ccggtgtgcaggcagcccatccaaatgattgtactcacttattttggctag

DBGET integrated database retrieval system